KEGG   Leishmania mexicana: LMXM_33_3940Help
Entry
LMXM_33_3940      CDS       T02288                                 

Definition
phosphatidylinositol 3-kinase-like protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33
AA seq 2628 aa AA seqDB search
MAETLAPNDVGGISVTKLFSSDSTAALGQQLSSIFSNLNSTPNDRQQRAEECLSALTDTL
FLHQNELGANESLHERIIVLIDGTFRASVDKGCSSFRVVFDVKWKDQHEKRNRCFVLLLS
RAFKCTTPEDCLKVIQCLGEVLEDNIRTTTDLLADHVEPLLRDLFAADVHRRTVACEVLA
KIVSTTTFIIKRNPTLLELLTSSCAPLVTLKDAMETRNLWHRTALIRLTSALVENCYEVT
PAVAKDVADLVFRYMGAAADESQLVGVLSALIHVAVTPAFVSAPWDLPQLVRFLCETDWS
VYAVATRVAAVAAINKVAFFICQEPKECYEALRTRSLEFISGDDAVEVVTEGLELLKDMQ
VLERELHFSGAVVNALCACIQRLPHLPIIYELLELIRERYGNLQVEPIYSLLEGYLDTKQ
ELLNFGKVNALLRFAGPRIRLDDPRLAQLRINVGANQPAPVILHSLPLLTTLQRTEQLHE
VLDILSHEDRGVRRVAVSTALELCVLVMERNKFRNATPKGNVQHLQWLDDEVRNAVERVL
DVAVADRDPEIRLWALQHLTVPFFPYLCLSDNLDAIFMARNDNDKATRDQALMLLCQLLP
YHPTAVQPQLQRAQEYMLHDVATMDASVSFAVCKAALLKMCVDHDALLIKGSTVEAIVLR
RLEAQPFISRSLSIALLQLIRSILERRASQHHSDFHSFLRPLLLIVNGGDSCTRRREALE
TLTAFISHITKTDISGLSEVYRAAARIIRRETEEEESVTIAAMKVLSSIGAVTPVKMRHV
FRMVESDEMEEEEEVVTPALAHCKPRLRISTDMPERYPSVVLYYLVRSLQLALDPKQQVD
TLVAVRTMLHDVEGKVKLNLLTQLLPQLQTWLRDSERAFLYETVLGLMNDLAILLCQFKE
TVAPSVGYELLRSVQAFCLLPQASQKPFSAYVVQLLDSLAKGIPAQEMRDNRWAIEFIHQ
RLSQNKNDLDLVHRVVKSLESFIAVMHEKELQMILPHVLQCIEPAKASPGGKLSKLKDIN
DACFDFLNFVMAKQLTLVKHCCAQIVHTIMWYIELADSDEEMDVGLNTLATLVDTVKLPA
KRFIMPIERVAVRNGFPPQYFINLVKSAAGGAKTRMTTSNGTGLNPDRPITVVSHLPRLS
QAEFEQEMRSTPRSEKVLIDVLDVRHDHGQTMIDFRFHPGTDTAACCNLFSRKATDNKSA
MRRNLGILRVEQTEESPRPVGAEVVKALANLPVAKTKKREQSWVLWLHNATVTLLRNSPY
AVLRDTCTVADRNTELARDLFPFAVAAVCGHLDTPLRAQLMDIFDRALAAAPADVKQGLF
CFAEFMESERDDNRVKLVKVMRESVFNVDRESASQKFGINYDQDPERGVIVTKLAPNGLG
NRAGVPIGAQLLAINDNPVRAVSDIRGLIEGLTHTELLLSYEVEEKTKSKPKPLMNLEVL
ASVAFSGEMHIKAIYFNEVLFESLSSKICTIADRKDSQMRRVMTIAEDLIQYYRHLNMTM
TANGLLKTLTRKFSDEIFAPEQFGFEEIASLEQLNWWSEALRRYEARMASFGTRCLEVAS
LVGVLRCEQALGHSSRVQQLAEQYWEQLPPDAQREVAPFRAKAAFCLGAWDTFDELALDK
RMQSCFGVVERCAALFRAECHDELLRYTDKVRESMLESFADSMNENYNRAYEGMTRLQHL
RHFEELVSFTTACEERQALLKRVWHRRLVQMSSRPDDLMTVLSINSLVLEPEDDLHSYVY
VIRCLCKSQWFSHAEHLLQRLLRENASLEVVCECDPELIHTYIKYVYLAKDKHGAYVELK
NILSAVEVDPEDPRAEMWGQCWLLLGEWTMYLFPECGEEAIKELMCATELGPNSAAAFHS
LGILHCDLARDPSTQGEVQNNHLICCINSLFKSIQLCNDVPGSLVMQDVLRILSVWFANS
GIREINEAVHHGVQVVADHVWLNVVPQLIARIGIEARYARAILTDLLIRVGSQYSHALIY
PLTVAEKSPDAVRRHMAERVIMGMRDIPENDRIVKEASLVSNEMVRIAILWTEKWHAAIQ
QAAYKPTNTAAIFSMLQPLYKELDRASTPNELSFRCNFGQTLRRAKVALEEANSEEAWGF
LRQVYAQLRRGVLERRLYMSDVSPTLDGIQDSIVAVPGTFEHDKPLITIRKFHSRVYVMP
SKQKPRRIGLDASDGKKYRFLLKGHEDMRQDERVMQFIRLIDTIFQSDNAASAIGLSIPQ
YAVIPLTDNVGVVGWVENTETIYKMLETYRQAHEVSIYEEVNIIMKKGGLDTIEDYHRLP
KQQRKALLNYAMENTPKNELRHIFWDHNDTCEQWLSYRQTYGQTLAAMSMVGYVLGLGDR
HLNNLMLQGNGTVVHIDFGDCFEVAMHRALYAEAVPFRLTRLLVCALGITGVDGLYRMTC
ELAMKNLHRHSENLLSILEAFIYDPIINWRLNTVNDVTEKSGSKSTQQESNNAGTAALAE
ETAAATCLGVDKAAQAEAKPVAMQLSKSVSKPAPHSILPGESQMFEHGEETRNQQGDLAL
ARVQAKLTGQDFGVVNSSFSMMRSSRRLEAGGSQQQGSSWGSNSLAGFTDSPKDSFAAPL
LTTYLSLRVLNGGAESLDVPHQVDRLIQEATSLDNLSDAFLTGWAPFW
NT seq 7887 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacgctagcccccaacgacgtgggtggtatctcggtcacaaagctcttcagc
agcgatagcaccgccgcgttgggtcagcagctcagttccatcttctcgaatctgaatagc
acgccgaatgaccgacagcagcgcgcggaggagtgcctcagcgccttgacagacaccctt
ttccttcaccaaaatgagcttggcgcgaacgagtcgctgcacgagcgcatcattgtcctc
atcgacggcaccttccgcgcctccgtggacaagggatgtagctcgtttcgcgttgtcttt
gacgtgaagtggaaggatcagcacgagaagagaaatcgctgcttcgtgctgctgctgagc
cgcgcattcaagtgcaccacgccagaggactgcctgaaagtaatccagtgtctcggtgag
gtactcgaggacaacattcgcacgacgacagaccttttagctgatcacgtcgagccgctc
ctcagagacctctttgccgctgacgtacaccgccgcaccgtcgcgtgtgaggtgcttgcc
aaaatcgtttcgacaacaaccttcatcattaagcgaaacccgacactgctggagcttctg
acatcatcgtgtgcgccgctggtgacgctgaaagatgcgatggaaactcgaaacctgtgg
caccgcacggcgctcatccgcctcacctccgctcttgtggagaactgctacgaggtgaca
ccggcagtggcgaaggacgtggccgacctcgtctttcgctacatgggtgccgcggcggat
gagtcgcagctggtcggcgttctctctgctctcattcacgttgccgtcacgccagcgttt
gtttcggctccgtgggatctgccacagcttgtgcgctttctctgcgagacggactggtcc
gtctatgctgtcgccacccgcgtcgccgccgtcgctgccataaacaaagtggcctttttc
atttgccaagagcctaaggagtgctatgaggcgctgcggacgcgttcgctggagttcatc
tcgggggacgacgctgtggaggtagtgacggaagggctcgagcttttgaaggatatgcag
gtgctggagagggagcttcacttcagtggcgccgtggtgaacgcgctctgtgcgtgcatc
cagcggcttccgcacttgccgatcatctatgagttgctggagctcattcgggaacgctac
ggcaatctccaggtagagccgatctactctctcttagaaggctacctagacaccaagcag
gagctgcttaacttcggcaaggtgaacgcgctgctgcgcttcgctgggccgcggattcgc
ttggacgacccaaggctcgcacagcttcgcatcaacgtgggcgccaaccaaccggctccc
gtgatcctgcactcactgccactgctgacaacgttacagcggacggagcagctgcacgaa
gtgctggacattctctcgcacgaagaccggggcgtgcggcgcgtcgccgtctccacagcg
ctggagctgtgcgttctcgtaatggagcgcaacaagtttcgaaacgccacgccaaagggc
aacgtgcaacacctgcagtggctggatgatgaagtgaggaacgcggtggagcgtgtgctc
gacgtcgccgtggcggaccgtgacccggagattcgactctgggcgctgcagcacctcacc
gtgcccttcttcccatacctgtgcctttccgacaacctggatgccatctttatggcacgc
aacgacaatgacaaggcaacacgggatcaggcactgatgctgctgtgccagcttctcccg
tatcacccgacggctgtgcagccgcagctgcagcgtgcgcaggagtacatgctgcacgac
gtcgccaccatggacgcgtccgtgtcctttgcggtgtgcaaggctgccctactgaagatg
tgtgtggaccacgatgccctcctcattaaggggagcaccgtcgaggcgattgtgctgcgg
cggctggaggcgcagcccttcatctctcgatcgctctccatcgctttgctgcagctcatc
cgctcgatcctggagcggagagcttcgcaacaccactccgacttccattcgtttctgcgg
ccgctcctcctcatcgtcaacggtggcgactcgtgcacacgccgccgcgaggcgttggag
acgctgacggccttcatcagtcacatcaccaagacggacatttcagggctgagtgaggtg
taccgagcagccgcccgcatcatccgccgcgagacggaggaggaggagtctgtgacgatc
gctgccatgaaggtgctcagctccatcggggctgtgaccccggtaaagatgcgccacgtc
ttccgcatggtggagtcggacgagatggaggaggaggaggaggtggtgacgccggcgctg
gctcactgcaagccgcggctgcgtatttccacggatatgccggagcgctacccctccgtc
gtgctgtactacctcgttcgctcgctgcaacttgcgttggatccgaagcagcaggtggac
acgctggtagcggtgcggacgatgctgcacgatgtggagggcaaggtcaagctgaaccta
ctcactcagctacttccgcagctgcagacgtggctgcgcgactcggagcgtgcgtttctg
tacgagacggtactgggtctgatgaacgacctcgccattctgctttgtcagtttaaggag
actgtagctccctcagtcggctacgagctactccggtctgtgcaagccttctgccttctc
ccgcaggcgagccagaagcctttcagcgcgtacgttgtgcagctactcgacagcctggcg
aagggcatccctgcgcaggagatgcgggacaatcggtgggccatcgagtttattcaccag
cgactctcgcagaacaagaacgaccttgacctggtgcaccgcgttgtcaagtccctcgag
tccttcatcgcagtaatgcacgagaaggagctccagatgatcctgccccacgtgctgcag
tgcatcgagccggcgaaagcatctccgggtggcaagctctccaaattgaaagacatcaac
gacgcctgtttcgacttcttgaactttgtcatggcgaagcagctgacccttgtgaagcac
tgctgtgcgcaaattgtgcacaccatcatgtggtacattgagctggcggacagtgatgag
gagatggatgtcggcctaaacacgctcgcgacgctggtggacacggtgaagttaccggca
aagcgatttatcatgcccatcgagcgcgtggccgtgcgcaacggctttccgccgcagtac
ttcatcaaccttgtgaagagcgctgccggtggagcaaagacccgcatgacgacatcgaac
ggcacaggcctcaacccggaccgccccattacggtggtgtcgcacctgccgcgtctgtca
caggccgagttcgagcaggagatgcgtagcacgccgcgctcggagaaggttctcatcgac
gtgctcgacgtccgtcacgaccacggccagaccatgatcgacttccgctttcaccccggc
acggacacggcggcgtgctgcaaccttttcagccgcaaggccaccgacaacaagtccgcc
atgcgccgcaatttgggtattctgcgcgtggagcagacggaggagagcccacgcccggtc
ggggcagaagtcgtcaaggcgcttgcgaacttgccggtggcgaagacaaagaagcgagag
caatcctgggtgttgtggctgcacaacgctacggtgacgcttctgcgtaattctccgtac
gccgtgctgcgggacacctgcaccgtcgcagaccgcaacacggagctggccagggatctt
tttcccttcgccgtggcagccgtgtgcgggcacctagacacgccgctgcgggcgcagctt
atggacatctttgaccgcgcgcttgctgcggcacccgccgacgttaagcaggggctcttc
tgctttgccgagttcatggagagcgaacgcgatgacaaccgcgtgaagcttgtcaaggtg
atgcgggagagtgtgttcaacgtggatcgcgagtcggccagtcagaaattcggcatcaac
tacgaccaggacccggaacgaggtgttattgtgacgaagctcgcccccaacggcctcggc
aaccgcgccggtgtcccgatcggggcgcagttgctcgctatcaacgataacccggtgcgc
gcggtcagcgatattcggggcctcattgagggactgacgcacacggagcttttactgtcc
tacgaggtggaagagaagacgaaatcgaagccgaagccgctcatgaacttggaggttctg
gcgtcggtcgccttcagtggggagatgcacatcaaggccatctacttcaacgaggtgctc
ttcgagagcctctccagcaagatctgcaccatcgcggaccgcaaggacagccagatgcgc
cgcgtcatgacgattgccgaggatctaattcagtactaccggcacttgaacatgaccatg
acagctaacgggctgctgaagacactcacgcgcaaattttccgatgaaatctttgcaccg
gagcagttcggcttcgaggagatcgcgtcgctggagcagctgaactggtggagcgaggcg
ctgcggcgatacgaggcgcggatggccagcttcggcacccgttgcctcgaggtggcgtcg
cttgtcggcgtgctccggtgtgagcaagcgttggggcactcgagccgcgtgcagcagctc
gccgagcagtactgggaacagctgccgccggacgcgcagcgcgaggtggcgcctttccga
gccaaggcagctttttgccttggggcgtgggacacctttgatgaactggcgttggacaag
cgcatgcagagctgcttcggcgtcgtcgagcgctgcgccgcgctgtttcgggctgagtgc
cacgacgagctcttgcggtacacggacaaggtgcgcgagtcgatgctcgagtccttcgcc
gactcgatgaacgagaactacaaccgggcatacgagggcatgacgcgtcttcagcacttg
cgccatttcgaagaactcgtctcatttaccacggcttgcgaagagcgacaggcgctgctg
aagcgcgtgtggcatcgccggctcgtgcagatgtcctcccggccggacgacctcatgacg
gtgctctccatcaactcccttgtgctcgagccggaggacgacctgcactcgtatgtgtat
gtcatccgatgtctgtgcaagtcgcagtggttctcccacgcggagcacctcctgcaacgg
ctgttgcgtgagaacgcgtctctcgaggtcgtatgcgagtgcgacccggaactgattcac
acctacatcaagtacgtatacctcgccaaggacaagcacggagcgtacgtggagctgaag
aacatcctgtccgccgtcgaggtcgaccccgaagacccgcgggccgagatgtgggggcag
tgctggctgctgctgggggagtggaccatgtatctcttccccgagtgtggcgaggaggcc
atcaaggagctcatgtgcgccacagagctgggccccaacagcgccgccgccttccactcg
ctgggcatcctgcactgcgacctcgcccgagacccgagcacgcagggcgaggtgcagaac
aatcacctgatctgctgcatcaactcccttttcaaatccattcagctctgcaacgacgta
ccgggcagcctcgtgatgcaggatgtactacgcattctctccgtctggttcgccaacagc
ggcatacgggagatcaatgaggcggtgcatcacggtgtgcaggtggtggcagaccacgtg
tggctgaacgtggtgccgcagctcattgcccgcatcggcatagaggcgcgctacgctcga
gccatcctgaccgacctgctcatccgcgtagggtcacagtactctcacgccctcatctac
cctctcacggtggccgaaaagtcgccagacgcggtgcggcggcacatggcagagcgcgta
atcatgggcatgcgcgacatcccggagaacgaccgcattgtcaaggaggcgtctttggtg
agcaacgagatggtgcgcatcgccattttgtggacagaaaagtggcacgcggcgattcag
caggcggcctacaagccaaccaacacggccgctatcttctccatgttgcaacctctgtac
aaggagctcgaccgcgcctccaccccgaacgagctcagcttcaggtgcaactttgggcaa
actctgcgccgcgccaaggtggccctggaggaggcgaactcggaggaagcgtgggggttc
ttgcggcaggtgtacgcgcagctgcgccgcggcgtactagagcggcggctgtacatgagc
gacgtctcgccgacgctggatggcattcaagacagtattgtggcagtgcccggcaccttc
gagcatgacaaacctctcatcacaatccgcaagttccacagccgggtatacgtgatgccg
tccaagcagaagccgcgccgcatcggtctcgacgcctctgatgggaaaaagtaccgcttc
ttactcaagggccacgaggatatgcggcaggatgagcgcgtcatgcagttcattcgactc
attgataccattttccagtccgataacgcggctagcgcgatcggactgagcatcccacag
tacgccgtgattccgctcaccgacaacgtcggcgttgtcgggtgggtggagaacacagag
acgatctacaagatgctggagacctaccggcaggcgcacgaggtttccatctacgaggag
gtcaacattatcatgaagaaaggtggactggacacaatcgaggactaccaccgactaccg
aagcagcagcgaaaggcgctgctgaactatgcgatggagaacacgccaaagaacgagctg
cgccacatcttctgggatcacaacgacacgtgtgagcagtggctgagctaccggcagacc
tacggtcagacactggctgccatgtctatggtcggctacgtgctcggcctcggtgaccgc
catctcaacaacctgatgctgcagggcaacgggacggtggtccacatcgactttggcgac
tgtttcgaggtggccatgcatcgcgccctctacgccgaggccgttccgttccgcctgaca
cgtctgctggtctgcgctctcggcatcactggcgtagatggtctttaccgcatgacatgc
gagctggctatgaagaacctccaccgccacagcgagaatctgctgtcgattctagaggcc
tttatctacgaccctatcatcaactggcgactcaacacggtcaacgatgtcacggagaaa
tcagggtccaagtcgacgcaacaggagagcaacaacgccggcaccgctgcactcgcagag
gagactgctgcggcgacgtgcttgggtgtcgacaaggcagctcaagcggaggcgaaacct
gttgcgatgcagctgtccaagtccgtttcgaagccggcgccgcactccatcttgccaggg
gagagccaaatgttcgagcatggcgaggagacgcgcaaccagcaaggggacttggcccta
gcacgagtgcaggcgaagctcaccggccaggattttggtgtggtgaacagctccttttct
atgatgcgctcctcgcgccgtctggaggctggcggctcccagcagcaggggtcatcgtgg
ggctcgaacagtctcgccggcttcaccgactcgcccaaggactcgttcgcagcgccgctc
ctgaccacctacctttcccttcgtgtgttgaacgggggtgcggagagcctcgacgtgccg
caccaggtggaccgcctcattcaggaggcaacgagcctcgacaacctatcggacgcgttt
ctcaccggctgggcacccttctggtag

DBGET integrated database retrieval system