KEGG   Leishmania mexicana: LMXM_33_4530Help
Entry
LMXM_33_4530      CDS       T02288                                 

Definition
phosphatidylinositol 3-kinase (tor2)-like protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33
AA seq 2438 aa AA seqDB search
MSSVDSEKLAASIRALACSRDERIAFVTEGVKQAKELQGKSVQEYEMVVSSLLMCLESFE
VVHGTSLDVLCELTVLDILLNLDLSVIQLSQCNSYLRLCLMAVNEIPVAVAAAKTFAQTL
SYSMTTDFVRTQIGETLEWISLPDAKSKPRRICGILVLTEVSLRIPMVILPRLSEVFDRV
WDCLAVHDEEVRSRALCLFTLCAKLLVNRPAAIRAETCESLMSHLKSNLASKSKDKRIAG
LLAFEPIVINSMGTSNLLYEDLSILLVPYIMRGGANVNADTRELLFRCLVVLCRFSVSQF
VASQLADSVRFALDSINRNIQRNTAFEMLSEIIPIVGKAEFAPFVDDTCEAIKTIFEKSS
SPCWKALQCFSIICKECRPSKMEMYVESCIENVFVWGLSAELIECMRAIIESSSVQYRAK
LEESLLDMISVTLCGLPFRQQIDAPRVNESSTDVSASEYQISVALNALKQFGFSNSELMG
DFLRVSVLPFIDNNSVAVRNAAVYTIVKLLIPHGEKGDLSIARRMCVNTVITRMLVVGLS
DPNPVVRQTILSAFTEDFYPYLSEQQYLFRFYSALGDESINCRVAATEQLCQMIRYDPSH
ILPALREEMVVILHFITSTFNMDTVQNGFRLLAAIATRAPQLVVNFTEGICEALVPYFST
LSSRSGILMSFLHCCTAVAAALRKFGSTPFSSKREVALVCELLETLPADRSYHIIRLSCL
RFLSATLAPLMEGASPYVLYPRLFQQLSTVLHRTEESVDIRLEALRCIGVIGALDSHVFQ
SFNVNEKEKACGKSAVVVDRVTHVKCCRIVLSAVAALLDPESKRSAGAREGLLRTGVQTM
LNIFEHVPCSKTEIGLVIGPLARVIRQLPGGRLFATVLFEFCNIIRYAGAVVLNDVNEIY
RVFDNVWEFQVNYRFLAVRMLSFVANFEAAGNLHYGQQHSRILPQLFDTLNRADLRPDLK
YAVLEYIVHHVDSLQPCTEAVVDNLLGAIQNPANPLDFVNHCVVTLKEICLKLYVDELVG
AIVRCLLACLSVDLARKTRGRDSIDLCNNIMGVFCVLIEELQDAFLKHSTYIIQALKNYR
ITNTEFGVMNNRVATGLRCTRSPMSIQQQNAEVAALLKTCESVVMKSMSRMGEVWSYANL
SDENINAAAAEERTMPINEQRLISPMKVVPLTKEEWVKWSDQFAITLLQESPFQVFRCTA
VPIGINAAPLVEKSAQFVQDTLQIAFRSMWNYASSALQTAITDFFRQSFRQAMVSTTVPA
EVVTMLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLI
SLYSELHMVDSSVGILNMTSEEQRRSLLQTSLVKLARYTEALQLTQQELELEAAPLEASG
SENLSKGCGYKNGSRGWSRMLHYASNSDITPSSSKVEESCRDRRVEVNARLMLCLSELGE
YDKVLEQWGSMLHNYKDRVTDTDEMHVLFFVSQYAADASIRLQSWDTLEHVLEWLPPDMV
LYHVSKAALEVVRGNYDAALVSVTNGRKVLLEDLTSLLHESYARAYEGLVVAQQLTEVEE
VIIAKQTQKALSSAAHIPHLCHIWEQRIRMMHATVPTWKQVLGIRGLLISPHDDVKTRIQ
FTKLCRQEKARQLEKFTLAELLGFANPTLEQLTSRNVNPRVVMQYISYLSDTNALGPGSP
FGTESDLIKKMIDVHTKAENSAVLARAYTRLGSKVDLIESVQCFKTATMYDPHWFLAWRK
WAEANAQLLQTDKGEETCRNAIEGFIRSIQLGTSDSTLIQDVLKLLTLWSNHCDSDHNLK
ELRERVFDVPSRVWHLVVPQLVARLDTGSDDSCRLVADVLTNVGYDYPHTLVYPLNLCTM
SDSERRKRYSNEVLGKLQERYPVLVLQGRLMIDELIRVSALIYEQWYDKLEAAATAFFGR
RSTDEMIRTLLPIHETLPRVPETVVEAEFLSKYSKRLTEARDWLRSYASTHYTGDIQSAW
KLYHSVYCKIDKQIKSSDTLQLQFCSPKLFEARNLSIGIPDARPVREESVANVNRFHKDI
IVIASKQRPKRIGIITAEGRLQKFLLKGREDLRLDERVMQLFSLVNILMQSDSRTSKNLG
FQIQRYSVTPLKDNVGIIGWVDGCDTLHEVVKHFRERKSIPVELEMRMLDQIITFDNSKA
YDYLTIMSKVEVLEFLSDHTSGQDIRKAMWNTSPNCEVWYDRRRMYTTSLANMSIVGYIL
GLGDRHPNNIMLQRASGLVVHIDFGDCFEVAMTRDKFPEKVPFRLTRMLRSALDVSGVDG
AFRACSETAMCVLREGSHSVLALLEAFIQDPLISWRLINRHGQEPESSNDHKTIEEQVNI
ANMRNATSAAEAESMCDSFGHRDNGSVNVPKHLCGEEMDVVHQGVFIVKRLSSKLKGQDF
ISAGTEPLDPRTQVGQLIEEATDVTNVAQSWSGWYPFW
NT seq 7317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtcgactcggagaaactggcggcctccatccgcgcactagcttgcagccgc
gacgagcgcatcgcctttgtgacggagggggtgaagcaagcaaaagagttgcagggcaaa
agcgtgcaggagtatgaaatggtggtgtcgtcgctgcttatgtgtctggagagctttgag
gtggtgcacggtacgtcgcttgacgtgctctgcgaactcactgtcctggacattctgcta
aacctagacttgtccgtcattcagctgtcgcagtgcaacagctacttgcggctttgtctc
atggcggtgaatgagattcctgtcgctgtggcagccgcaaagacgtttgcgcagacgctt
agctacagcatgacgacggactttgtgcgcactcaaatcggagagacactcgagtggatt
tcgctccccgatgccaagtcgaagcctcgccggatttgtggcatcttggtgctcacggag
gtttcgttgcgcattccaatggtgattctgccgcgcctctccgaggtgttcgatagggtt
tgggactgcttggcggtgcatgatgaggaggtccgctcgcgcgctctgtgtctcttcacg
ctatgcgcaaagctgctggtcaaccgtcctgccgccattcgtgcggaaacctgcgagtca
ttgatgtcacacctgaagagtaacctcgcctcaaaatcaaaggacaaacgcattgctggc
ctccttgcattcgagcccattgtcatcaactcgatgggcaccagcaacctactttacgaa
gacctctccatccttttagtcccgtacatcatgaggggcggcgcgaacgtcaacgccgac
acgcgcgagctcctcttccgctgcctggttgtcctctgccgcttcagtgtatcacagttt
gtcgcgagccaactcgcggacagtgtgcgcttcgcgctggactccatcaaccgcaacatt
cagcggaacaccgccttcgagatgctctctgagatcattccgattgtcggcaaggcagag
tttgcgcccttcgtcgacgacacgtgtgaagcaatcaagactatttttgagaagtcctcg
agcccgtgctggaaggcgctgcagtgtttctccatcatttgcaaagagtgccggccatcc
aagatggaaatgtacgtggagtcgtgcatcgagaacgtgtttgtgtggggactttccgcg
gagctgattgagtgcatgcgcgccatcattgagtcgtcgagcgtgcagtaccgagcaaag
ctggaggagtcgctgctcgacatgatctccgtcacactatgtggtctcccatttcgacag
cagattgacgccccgcgcgtgaatgagagctctacagatgtgagcgcctccgagtatcag
atctccgtcgccctgaacgccctcaagcagtttggcttctccaactcggagctcatgggc
gacttcctgcgcgtctcggtgctgccttttatcgacaacaacagcgtcgccgtgcgcaac
gcagctgtctacacgattgtcaagcttctcatccctcatggcgagaaaggtgacctcagt
atcgcacgtcgcatgtgcgtcaacaccgtcatcacgcgcatgctggtagtggggttgtca
gaccccaatccggtggtgcgtcagaccattctgagcgcctttacagaggacttttatcca
taccttagcgagcagcagtatctctttcgcttctactctgccctgggcgacgagtctatc
aactgtcgcgtggcggcgacggagcagctctgccagatgatccgctatgacccgtctcac
attctgcctgcgttacgggaggagatggtcgttattctacacttcattacgtccaccttt
aatatggacaccgtccaaaacgggttccgcctcctcgcggccatcgccacgcgcgcgccg
caactggtagtgaactttacggaaggcatctgtgaggctctggtgccgtactttagcact
ctctcgtcccgctccggcattctcatgtcgttcttgcactgctgcacagccgtcgcggcg
gcgctccgaaagttcggcagcacccccttctcttccaaacgtgaagtcgctctcgtgtgc
gagctgttggaaaccttgccagcggaccggtcgtatcacatcatccggctgtcctgtctc
cgcttcctatcagcaaccctggcgccgctcatggaaggtgcctcgccgtacgtgctgtat
cctcggctctttcaacaactcagcacggtgctgcatagaacggaggagagcgttgacatc
cgccttgaagcgcttcggtgcattggcgtgatcggcgcgctggactcgcacgtgttccag
tccttcaatgtcaacgagaaggagaaggcgtgtgggaagagcgcggtggtggtggacagg
gtgacacacgtgaagtgctgccgtattgtgctcagcgcggtggcggcgctgcttgacccg
gagagcaagcgctctgctggcgcgcgcgaagggttgcttcgcacgggtgtacagacgatg
ctgaacatctttgagcatgttccgtgctccaagactgaaattggtctcgtgattggtccg
ctggcccgcgtcatccggcagctgcctggcggccgcctctttgccaccgtgctcttcgag
ttctgcaacatcattcgctacgccggcgcggtggtgctcaacgacgtgaacgagatttac
cgcgtatttgacaatgtatgggagtttcaggtcaactaccggtttctggccgtgcgcatg
ctttcgtttgtcgccaacttcgaagccgccggcaatctgcactacggtcagcaacactcg
cgcatcctgccgcaactcttcgacacgctcaaccgtgctgacctgcgccccgacctcaag
tacgctgtactggagtacattgtgcaccatgtcgactccctgcagccgtgcacggaggcg
gtggtggataacctcctcggcgcaatacagaacccggcgaatccgcttgactttgtgaac
cactgtgtggttacactcaaggagatctgcctcaagttgtatgtcgatgagctcgtcggc
gctattgttcggtgtctgctggcgtgcctttccgtcgaccttgcgcgcaagacacgcggg
cgcgatagtattgatctctgcaacaacatcatgggggtcttctgcgtcctgatcgaggag
ctgcaggatgcttttctcaagcactcaacgtacatcattcaggcgctgaagaactaccgc
atcacaaacaccgaatttggcgtaatgaacaaccgcgtcgccacgggcctccgctgtaca
cgcagcccaatgtcgattcagcaacaaaacgcggaggttgcagcgctactgaagacgtgc
gaatccgttgtcatgaagagcatgtcgcgcatgggcgaggtctggagctacgcgaacctc
agcgacgaaaacataaatgccgctgccgcggaggagcgcaccatgcccatcaacgagcag
cgtctcatcagtccaatgaaggtcgttcccctcacgaaggaggagtgggtcaaatggtcg
gaccagttcgccatcacgctgctgcaagagtcgccgtttcaggtcttccgctgcacggcg
gtgcccatcggcatcaacgcagccccgctggtcgagaaatcggcgcagtttgtgcaagac
acactccaaatcgcctttcgctccatgtggaattacgcgagctcggcgctgcaaactgct
atcacggactttttccggcagtcctttcgccaggcaatggtgtcgaccactgtcccggcg
gaggtggtgacgatgttgcttggtatcgtagagtacatggaccacgttggcgaggctttg
tttatctcgtacaatgacctctccgagtgcgcgtggaaccgcggaatgttggccaaggcg
ctcttctggcgcgaggccgcctaccgcgacgaccctgtcggcaccgtcgagtcactcatc
tctctttacagtgagctgcacatggtggactcctccgttggaatcttgaacatgaccagc
gaggagcagcgacgcagcctgctgcagacaagcctggttaagctcgcgcgctacacggag
gcgctccagctgacgcagcaggagctggagctggaggctgccccgttggaggcgagcggc
tcggagaacttatccaagggctgcgggtacaagaacggcagccgcggttggtcgcgcatg
ttgcactacgcgtccaacagcgacatcaccccgtcctcctcaaaggtggaggagagctgt
cgtgaccgccgcgtggaggtaaacgcgcgactgatgttgtgcctgagcgagcttggcgag
tacgacaaggtgctggagcagtggggcagcatgctccacaactacaaggaccgcgtgaca
gatacagacgagatgcacgtgctgttttttgtctcgcagtacgccgcagacgcgtcgatc
cggctgcagtcgtgggacacgctggagcacgtcctggagtggttgccgcccgacatggtt
ctctaccacgtgtcgaaggcggccctggaagtggtgcgcggcaactacgacgccgcgctc
gtctccgtgacgaacgggcgcaaggtactgctggaggatctgacaagcctgctgcacgag
tcgtacgcgcgcgcctacgaggggctggtagtggcgcagcagctgacggaggtggaggag
gtcatcatcgcaaagcagacgcaaaaggcgctcagctccgccgcacacataccgcacctc
tgccacatctgggagcagcgcattcgaatgatgcatgcgacagtaccgacatggaagcag
gtgctgggaatccgtggcctactcatctcgccccatgatgacgtgaagacgcgcatccag
ttcaccaagctctgtcggcaggagaaggcgcgacagctagagaagtttacgctggccgag
ctcctcgggttcgcaaacccgaccctggagcaactcacaagccgcaatgtgaacccacgc
gtggtgatgcagtatatctcatacctctccgacaccaacgcacttggccccggcagtccc
ttcggaaccgagagcgacctcatcaagaagatgatcgacgtgcacaccaaggcggaaaac
tcggcagtgttggcgcgggcgtacacgcgcctcgggagcaaggtcgatctcatcgagtct
gtgcagtgcttcaagacggccaccatgtacgatccacattggtttctggcgtggcgtaag
tgggcggaggcgaatgcccagctgctccagacagacaagggcgaagaaacctgccgcaac
gctatcgagggctttatccgaagcattcagcttggaacgtccgattcgacgctcattcaa
gacgtgctcaagctgctcacgctctggtcgaaccactgcgactctgatcacaacttgaag
gagctgcgcgagcgtgtcttcgatgtaccgtcgcgcgtgtggcaccttgtggtgccacaa
ctggtcgcccggctcgacaccggctctgacgacagctgccggcttgtggcggatgtcctg
accaacgtgggctacgactacccacacacgttggtgtacccgctgaacctgtgcactatg
tctgactcagagcgccgtaagaggtactccaatgaggtgctaggaaagctgcaggagcga
tatccagtgcttgtgctgcagggtcgactcatgattgacgaactcatccgcgtctcggcc
ctcatctatgagcagtggtatgacaagctggaggcggcggcgaccgccttctttggccgc
cgcagcaccgatgagatgatacgtacactgctgccgattcacgagacgttgccacgggtg
ccagagacggtggtggaagctgaatttctgtccaagtacagcaagcgtctgaccgaggct
cgggactggctgcgatcgtacgcgtcaacgcattacaccggcgacattcaatctgcatgg
aaactgtaccacagcgtgtactgcaaaatcgacaagcagatcaaatccagcgacacacta
cagctgcagttctgcagtccgaagctgtttgaggcgcgcaacctctctatcgggatcccc
gacgcgcggccagtccgcgaggagtcggtagcaaatgtgaaccgctttcacaaagacatc
atcgtcattgcaagtaagcagcggccgaagcggatcggcatcatcacggcggagggcagg
ctgcagaagtttctgctcaaagggcgcgaggacctccgcctggacgagcgcgtcatgcaa
ctcttctcgcttgtcaacatcctcatgcaatccgactcgaggacaagcaagaacttaggc
ttccagatccagcgctactccgtcacgccgctcaaggataacgtcggtatcattggctgg
gtcgacggctgcgacacgctgcacgaggtcgtcaagcactttcgcgaacgcaaatcgatc
ccggtggaactggagatgcgcatgctggaccagatcatcacctttgacaactccaaggcg
tacgactatctgaccatcatgtcaaaggtagaggtgttagagttcctctccgatcacacc
tccgggcaggacattcgcaaggccatgtggaacacgtcgccgaactgcgaggtctggtac
gatcgacgccgcatgtacacaacgtcgttggcaaatatgagcatcgtaggctacatcctc
ggcctcggcgatcgccacccaaacaacatcatgctgcagcgcgcgtcgggattggtggtg
cacatcgactttggtgactgctttgaggtggccatgacgcgcgacaagtttcccgaaaag
gtgccgttccggctgacacgcatgttgcgcagcgcgcttgacgtgtcgggcgtcgacggg
gcgtttcgcgcctgctcggagacggcgatgtgcgtgctgcgcgagggcagccacagtgtg
ctggccctcctcgaggcattcattcaagacccgcttatttcatggcgcctcatcaacaga
catgggcaggagccggagtcgtcgaacgatcacaagaccatcgaagagcaggtgaatatt
gccaacatgcgcaacgccacgtcggcagcggaggcggagtccatgtgtgactcgtttggg
caccgcgataacggttccgttaatgtcccaaagcacttgtgtggggaggaaatggatgtg
gttcatcaaggcgtgttcatcgtcaagcgcctcagctccaagctcaaagggcaggacttt
atctcggctggtacggagcccctcgatccacgcacgcaggtagggcagctcattgaagaa
gccacagacgtgacgaatgtggcacagtcctggtcgggatggtacccgttctggtag

DBGET integrated database retrieval system