KEGG   Leishmania mexicana: LMXM_34_1480Help
Entry
LMXM_34_1480      CDS       T02288                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lmi  Leishmania mexicana
Pathway
lmi00220  Arginine biosynthesis
lmi00330  Arginine and proline metabolism
lmi01100  Metabolic pathways
lmi01110  Biosynthesis of secondary metabolites
lmi01130  Biosynthesis of antibiotics
lmi01230  Biosynthesis of amino acids
Module
lmi_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    LMXM_34_1480
   00330 Arginine and proline metabolism
    LMXM_34_1480
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     LMXM_34_1480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 13450861
NCBI-ProteinID: XP_003879144
UniProt: E9B627
Structure
PDB: 

Jmol
Position
34
AA seq 329 aa AA seqDB search
MEHVQQYKFYKEKKMSIVLAPFSGGQPHSGVELGPDYLLKQGLQQDMEKLGWDTRLERVF
DGKVVEARKASDNGDRIGRVKRPRLTAECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGT
VAGVLSVHPDAGVIWVDAHADINTMSGTVSGNLHGCPLSILLGLDRENIPECFSWVPQVL
KPNKIAYIGLRAVDDEEKKILHDLNIAAFSMHHVDRYGIDKVVSMAIEAVSPKGTEPVMV
SYDVDTIDPLYVPATGTPVRGGLSFREALFLCERIAECGRLVALDVVECNPLLAATESHV
NDTISVGCAIARCMMGETLLYTPHTSSKL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgtgcagcagtacaagttctacaaggagaagaagatgagcattgtgcttgcc
cccttctccggcggccaaccgcacagtggggtagagctgggtcctgactacctcctcaag
cagggactgcagcaggacatggagaagcttggatgggatacaaggctcgagagggtgttc
gacggcaaggttgttgaggctcgcaaggcgagcgataatggcgacaggatcggtcgtgtc
aagcgcccgaggctgacagcggagtgcacggagaagatctacaagtgtgtgcgcagggtg
gccgagcagggtcgctttcctctcaccatcggtggcgatcactccatcgccctcggcacg
gtggccggtgtgttgtccgtgcacccggatgccggggtgatttgggtggacgcccacgcg
gacatcaacactatgtctggcacggtctccggcaacttgcacggctgccccttatcgatc
ctgttggggcttgatcgcgagaacattcccgagtgcttttcgtgggtaccgcaggtgctg
aagccgaacaagattgcctacattggtctgcgtgctgtggacgacgaggagaagaagatc
ctgcacgacctgaacatcgccgccttcagcatgcatcacgtggaccgctacggcatagac
aaggtggtgtccatggcgatcgaagccgtctcgccgaagggtacggagccggtgatggtg
tcatacgacgtggacacgatcgaccccctctacgtcccggcgacgggcactcccgtgcgt
ggcggcctctctttccgcgaggcgttgttcttgtgcgagcgtatcgccgagtgcggtcgt
cttgtcgctctggacgtggtggagtgcaacccgctcctcgccgctacggaatcgcacgtg
aacgacaccatctccgtcggctgcgccatcgcacgctgcatgatgggagagacacttctt
tacactccgcatacgagctccaagctatag

DBGET integrated database retrieval system