KEGG   Leishmania mexicana: LMXM_34_1740Help
Entry
LMXM_34_1740      CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C19,putative
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LMXM_34_1740
Peptidases [BR:lmi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMXM_34_1740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34
AA seq 1164 aa AA seqDB search
MLAVLDVAKHVFWNDTAFNRKLLPSEAALEKCSYTIADLTTMTGKERISVFKQCGIDPSL
FPLFLRSLQHITALHGAGKIDGNCMIHRHLSARQWSPFYANTPLLGYASVNSLSYREQCS
SAAKETKRDDVADLERGRTCHSHYNGLLNQGATCYLNSLLQALFHITAFRVIIYHMPTKD
EAEQHADLESTVPRSIPYALQRLFCHLQMSTRAVGTRELTESFGWGASDSFIQHDVHELT
RVLLDNLEEKLNAQQAETGNPKPKENAIHRLFTGSLESYVKVEEANYYGSREEPFYDLQL
VVKNKKNIYSSFDTFFQVEVLDGKNKYCLECNGKKSYHRAEKGVRLKTIPPILLLHLARF
DYDIQQGETKVLTRWDYYNTLDLSRYMPESPSMDTHYTLCSVLVHSGPNTGFGHYFCFIL
CSGAWYKFNDEAVTPAKLKEVFGDNFGGFKLNYWGSEIPNTANAYMLVYIRTSQLNSILC
PIGSDDVPQHVVQQLERERVEHERRVKEQAEDYLYGRVHFILPNEITDQEEYLTSRRPAA
QKFSSHRTLRIPLDDEALPAFEAFVKRQLGVDAEQQLLWFASSRTGGSEIRLSKQVRANM
KVQQLLQNAKECCILVTTPATATVIELDQGCAHREYQVFHHKLYDPLQLKVLFLGCTVLH
RDPNGDTKQALESMVSHVRALIADLPDPTKQLHGHHLTKPPKARQTLPSKPRSATSLETY
RSNQDLSSRDEAETTEVKRGMPQEALGVVRETEAREFLPCSELHSGDILIWKLDTPNEDP
ANIFYPDIQSYQHFLLHRIPVELKLNRYPDYPLLIATELAEDMTYEQLQRYVARLIGDME
NYDRVRFTRHNPETELPYFMKGKKHDRATLARLLMPASSRVPALSKYLYYEYCKYTVTEI
ENAHSLQFKLYDDNVKVVSTHWILLPHDLPITADLLFPACVSEIQKDYAAGACPAVAALL
KEDPENTSNNSTIAFVKRLMQMDCKSAHEWLRLVDVWRGRVYNILDKNHTLVFEHNTFEE
SAEYRIEHLPAPIPGVPSSDQAVFQVHHFTMVRQRRDAIETHSEPFSMYVNFYETSNQLL
RRIAAKLEMIYAAVQDWKVCLVKESRVEVIAPDALMGVHITNFCLPECYKPNQIEPSKAA
FIGLEHAPLSKRTGKREDKVLILN
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcagttttagacgtggcaaagcacgttttttggaatgacactgccttcaataga
aagctgcttccctcggaggcagcgctggaaaaatgcagctacacgattgctgacctgacg
accatgacagggaaagagcggatctctgtcttcaagcagtgcgggattgacccatccctc
tttcctctttttttgaggtcccttcaacacatcactgctcttcacggtgccggtaaaatt
gacggcaattgcatgattcatcggcatctgagcgcgcgccagtggagtccgttctacgcc
aacactcctcttctcggctacgcaagcgtgaatagcctatcgtacagagagcagtgttca
tctgcggcgaaggagacaaagagggatgatgtagctgatctggaaagaggtcggacctgt
cactcccactacaacggtttgctcaatcagggcgcgacctgctacctcaactcgctcctc
caggctctcttccacatcacagcatttagggttattatctatcacatgccaacaaaagac
gaggcggagcagcacgctgacctggagtcgacagtgcccagaagcattccgtatgccctg
cagcgactcttttgccacttgcagatgtcgacgcgcgctgtcggcacacgcgagctcact
gaatcattcggatggggcgcatccgatagctttatccagcacgatgtgcatgagctgaca
cgcgttcttctagacaatttggaggagaagcttaatgctcaacaagctgaaaccgggaat
ccgaagccgaaggaaaatgcgattcatcgcctcttcacgggctccttggaaagttacgtg
aaggtcgaagaggcaaactactacggctcccgtgaagagccgttttatgacctccagctc
gttgtgaagaacaagaagaacatatactcgagcttcgacacctttttccaggttgaggtg
ctggacggaaaaaacaagtactgcctggaatgcaatgggaaaaagtcgtatcatcgtgca
gagaagggcgtccgtctcaagacgatcccccccatccttcttctgcaccttgcacgcttt
gactacgacattcagcagggtgagacaaaggtgttgacgcgctgggactactacaacact
ctggatttgtcgcgttacatgccagagtctccgtcgatggacacgcattacaccctgtgc
agcgtgctggtacactccgggccaaacaccggctttggtcactacttttgcttcattctg
tgctctggcgcgtggtacaagttcaacgatgaggcggttaccccggcaaaactgaaggaa
gtgtttggtgacaactttggtggcttcaagcttaactactggggttctgagatcccaaat
actgccaacgcctatatgcttgtgtacatccgcacgagccaactgaactccattctatgt
ccgatcggcagcgatgacgtcccacaacacgtcgtgcagcagctggaaagagagcgtgtt
gaacacgagcgtcgcgtcaaggagcaggcggaagactacctttacgggcgggtgcatttt
attctgccaaacgaaatcaccgatcaggaagagtaccttacgtcgcgtcgaccggcagcg
cagaagttctcttctcacaggactctgcgcattccgctcgacgacgaagcattgccggct
tttgaggcgtttgtgaagcggcagctgggtgtcgacgccgagcagcagctgctgtggttt
gcctcatcgcgcactggcgggtcagagattcggctttctaagcaggtcagagcgaacatg
aaggtgcaacagctcctgcaaaacgcaaaggagtgctgcatacttgtcacaactccagca
actgccacagtaattgagctcgaccagggctgcgcacaccgcgaataccaagtgtttcac
cacaagctgtacgacccgctgcagctcaaagtcctttttctagggtgcaccgtgctacat
cgcgatccgaacggggacacaaagcaggctctcgaaagcatggtgtcacatgtgcgcgcc
ctcatcgccgatctgccagacccgacaaagcagctgcatggccatcatctcacgaagccg
ccgaaagcgaggcagacactgccgtcgaagccacggagtgccacctcacttgagacctac
aggtcgaatcaggacctttcctcgagggatgaggcagagacgaccgaagtgaagcgcggt
atgccgcaggaggcgttgggggtggtgcgcgaaactgaggcgcgcgagtttttaccgtgc
agcgagcttcactcgggtgacattctgatctggaaactcgacacaccgaacgaagatccg
gcgaacattttctaccccgacatccagagctaccagcatttcctcctgcaccgaatcccg
gtggagctgaaactaaaccgctacccggattatcccctgctgatcgcgaccgagcttgca
gaggacatgacgtacgagcagcttcagcggtacgtcgcacggctcattggtgacatggag
aactacgaccgcgttcgcttcactcgccacaacccggaaacggagttgccatacttcatg
aagggcaagaaacacgatcgtgcaactttggcgagattgttgatgcctgccagttcgcgg
gttcccgccctgtccaagtacctctactacgagtactgcaagtacaccgtcaccgaaatt
gagaatgcgcactcgttgcagtttaagctgtacgacgacaatgtcaaagtggtgtcgacg
cactggattctgctgccgcatgatcttcctatcacagcggacctgctctttcccgcctgc
gtgagcgagattcaaaaagactacgccgccggtgcctgcccggcggtagcggcgctgctc
aaggaggatccagaaaacacatccaacaactccacaatcgcctttgtgaagcggctcatg
cagatggactgcaagagtgcgcacgagtggctgcgtctggtcgacgtgtggcgcggtcgt
gtgtacaacatactggacaagaatcacacgcttgtcttcgagcacaacaccttcgaagaa
agcgcggagtatcgtatcgagcaccttcctgcacccatcccaggtgtcccctcctcagac
caggcggtgtttcaggtgcatcacttcaccatggtgcgccagcgtcgcgacgctatcgag
acgcacagtgagcctttcagcatgtacgtcaacttctacgaaacgtcgaatcagctgtta
cgccgcatcgccgcgaagctggagatgatttacgccgccgtgcaggattggaaggtttgt
ctagtgaaggaaagccgggtagaggtgattgcgccagatgctctgatgggtgtccacatt
accaacttctgtcttccagagtgctacaagccgaaccagatcgagccttcgaaggcggct
ttcattggactggagcacgccccgctctcaaagcgaacaggcaagcgtgaggacaaggtg
ttgatcctcaactga

DBGET integrated database retrieval system