KEGG   Leishmania mexicana: LMXM_34_3080Help
Entry
LMXM_34_3080      CDS       T02288                                 

Definition
putative glycerol kinase, glycosomal
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmi  Leishmania mexicana
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LMXM_34_3080
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LMXM_34_3080
Exosome [BR:lmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMXM_34_3080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34
AA seq 512 aa AA seqDB search
MPCVASIDQGTTSSRCIIFDETFTILSAHQLFHKQITPRPGWLEHDPEEIYSNCCLCLAE
ALKKLRSKDPKLAKVAAIGITNQRETGVAWDRKTGKPLCNAIVWSDARTYEVSNRIATQC
GGGDSNFAAKITGLPVSTYFTAFKFRWMLENVPAVAAARKSGSLLLGTIETWLLWKLSEG
KVFVTDVSNASRTFLMNLRTQQWCDKLCQELDIPRAALPEIRSNSERYCDVTANDHGIRD
ALGVPTPVTGCIGDQQSALFGHIGLQKGDAKNTYGTGCFVLMNVGAEPQFSKHGLLGTIA
YKLGTEPAKFALEGSIAGAGATVEWMRSNLGFFDHPMEMESIARKVSDTDGVVLVPAFGG
LLAPYWDPTARGTLVGMTYKTNKSHIIRAALEAISMQVNAVMLAMKEDSGVEINCLRVDG
GLTRSRLLMEMQADILGVNLYVPHLTETTALGAALCAGLAVGVWKSIEEVQKTAKDHLRG
ETVAPVTTDEQVRKARLDAWNAAVKLSQWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgcgtcgcgtctattgaccagggcaccacctctagtcggtgcatcatcttcgac
gaaacgttcaccattctctcagcgcaccagctgttccataagcagatcacgccgcggcct
gggtggctggagcacgatccggaagagatctacagcaactgctgcctctgccttgccgag
gcgctgaagaagctgcggtcaaaagaccccaagctcgccaaagtggcagcgataggtatc
acgaatcagcgtgagacgggtgtcgcctgggaccgcaagaccgggaagccactgtgcaac
gccattgtgtggagcgacgcccgtacctatgaggtgagcaaccgcatcgcgacacaatgt
ggcggcggcgacagcaactttgccgccaagattactggcttgcccgttagcacctacttc
accgccttcaagttccgatggatgttggaaaatgtcccagccgtcgccgcggcgcgtaag
agcggctcgctactcctcggcactatcgagacgtggctgctgtggaagctgagcgagggc
aaggtgtttgtgacggatgtgtccaacgccagtcgcaccttcctaatgaacctgaggacg
cagcagtggtgcgacaagctctgccaggagctcgacattccacgcgccgcactgccggag
attcgcagcaacagcgagcgctactgcgatgtcacagccaacgatcacggcatccgcgat
gctctcggcgtgccgacgcccgtgacgggctgcattggcgaccagcagagtgccctgttt
ggccacataggtctgcaaaagggtgatgccaagaacacgtatggcacaggctgttttgtg
ctcatgaacgtgggtgcggagccgcagttctcgaagcacggcctgcttggcactattgcg
tataaactgggtaccgagccggccaaatttgccctggagggctccattgctggcgccggc
gccacggtggagtggatgcggtccaaccttggcttcttcgaccaccccatggagatggag
agcattgcccgcaaagtgagcgatactgacggagtcgtgctcgtgcctgccttcggcggt
ctgctcgccccgtactgggacccgactgctcgtggcacccttgtaggcatgacgtacaaa
acgaataagtcgcacataatccgcgccgccctcgaggccatctccatgcaggtgaacgca
gtgatgcttgctatgaaagaggacagcggcgttgagatcaactgcctgcgcgtcgacggt
gggctcacgcgcagtcgcctgctcatggagatgcaggctgacatcctgggtgtgaacctt
tacgtcccgcatctcaccgaaacgaccgctcttggcgccgccctttgcgctggcctggct
gttggcgtctggaagtcgatcgaggaggtgcagaagacggccaaggatcacctgcgcggc
gagactgtggccccagtcacgacagatgagcaggtgcgcaaggctcgcctggatgcctgg
aacgccgccgtgaagctgtcgcaatgggcgaagctgtaa

DBGET integrated database retrieval system