KEGG   Leishmania mexicana: LMXM_34_3960Help
Entry
LMXM_34_3960      CDS       T02288                                 

Definition
protein kinase A catalytic subunit isoform 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LMXM_34_3960
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LMXM_34_3960
Messenger RNA biogenesis [BR:lmi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LMXM_34_3960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34
AA seq 382 aa AA seqDB search
MLVSVEPKPEVAGTVHAPLRPRRTSVRGASPIIPTPSRLVHAASPRTWSSSLKPKVGCTF
ERPDTSSWKLSDFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQ
EKGILMEVCHPFIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAEL
VLAFEYLHSLDVIYRDLKPENLLLDNKGHVKVTDFGFAKKVPDRTFTLCGTPVYLAPEVI
QSKGHGKAVDWWTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVK
ALLQTDHTKRLGSLKGGLADVKNHPYFHGVNWSKLYARYYPAPIPVRVKSPGDTSNFEKH
PDSPVDRTPALTSAQQAEFKGF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgctagtgagtgtggagccgaaacctgaggtggctggcacagtccacgcaccccttcgg
cccaggaggacgagtgtacgcggtgcgtctcccattatccccactccgtccagattggtg
catgctgcgtcccctaggacgtggtcctcctctttgaaacccaaggtcgggtgcaccttt
gagaggccggacacctccagctggaaactctcggacttcgaattgaaaaacacgctcggc
accggctccttcggccgcgtgcgcatcgctcaccgcaagggcacggaggagtactacgcg
atcaagtgcctgagaaagcgtgagatcatcaagatgaagcagcagcagcacgttgcgcag
gaaaaggggatcctaatggaggtgtgtcacccgttcatcgtgaacatgatgtgctccttc
caggacgagaagaaggtgtactttgtgctggagttcgtgatgggcggcgagatgttcacg
cacctgcgcactgctgggcggttcccgaatgacgttgcgaagttctaccacgcggagctg
gtgcttgcgttcgagtacctgcactcgctggacgtgatctaccgcgatctgaagccggag
aatctgctgctggacaacaaggggcacgtgaaggtgacggactttgggtttgcgaagaag
gtgccggaccggacgttcacgctgtgcgggacaccggtgtatcttgcgccggaggtgatc
cagagcaagggccacgggaaggcggtggactggtggacgatgggcgtgctgctgtacgaa
ttcattgctggatacccgccgttctacgatgacacgccgttccggatttacgagaagatc
cttgctgggcggctgaagttcccgaactggtttgacggccgcgctcgcgaccttgtgaag
gcgctgctgcagacagaccatacgaagcgcctggggtcgctgaaaggcgggctagcggat
gtgaagaaccacccgtacttccacggcgtgaactggagcaagctgtacgcccgctactac
cccgcgccgatccctgtgcgggtgaagagccctggcgacacgagcaacttcgaaaagcac
ccggacagcccggtcgaccgcacgcctgcgctgacgtcggcgcagcaggccgaattcaag
gggttctaa

DBGET integrated database retrieval system