KEGG   Leishmania mexicana: LMXM_34_4010Help
Entry
LMXM_34_4010      CDS       T02288                                 

Definition
(RefSeq) protein kinase A catalytic subunit isoform 1
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
34
AA seq 371 aa AA seqDB search
MSSAAKDSYPAESLGQLSSEKAQTSKAPSSHPDSPKGAVTPNAKATYSFERPDTSSWKFS
DFELKNTLGTGSFGRVRIAHRKGTEEYYAIKCLRKREIIKMKQQQHVAQEKGILMEVCHP
FIVNMMCSFQDEKKVYFVLEFVMGGEMFTHLRTAGRFPNDVAKFYHAELVLAFEYLHSLD
VIYRDLKPENLLLDNKGHVKVTDFGFAKKVPDRTFTLCGTPEYLAPEVIQSKGHGKAVDW
WTMGVLLYEFIAGYPPFYDDTPFRIYEKILAGRLKFPNWFDGRARDLVKALLQTDHTKRL
GTLKGGPADVKNHPYFHGANWSKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRTPAL
TSAQQAEFNGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgctgccaaggacagctatccggcggagtcattgggccaactcagcagcgag
aaggcgcagacgtcgaaggctccctcaagtcatcccgactccccgaagggggctgtcacg
ccaaatgccaaggccacctattcctttgagaggccggacacctccagctggaaattctcg
gacttcgaactgaaaaacacgctcggcaccggctccttcggccgcgtgcgcatcgctcac
cgcaagggcacggaggagtactacgcgatcaagtgcctgagaaagcgtgagatcatcaag
atgaagcagcagcagcacgttgcgcaggaaaaggggatcctaatggaggtgtgtcacccg
ttcatcgtgaacatgatgtgctccttccaggacgagaagaaggtgtactttgtgctggag
ttcgtgatgggcggcgagatgttcacgcacctgcgcactgctgggcggttcccgaatgac
gttgcgaagttctaccacgcggagctggtgcttgcgttcgagtacctgcactcgctggac
gtgatctaccgcgatctgaagccggagaatctgctgctggacaacaaggggcacgtgaag
gtgacggactttgggtttgcgaagaaggtgccggaccggacgttcacgctgtgcgggaca
ccggagtatcttgcgccggaggtgatccagagcaagggccacgggaaggcggtggactgg
tggacgatgggcgtgctgctgtacgaattcattgctggatacccgccgttctacgatgac
acgccgttccggatttacgagaagatccttgctgggcggctgaagttcccgaactggttt
gacggccgcgctcgcgaccttgtgaaggcgctgctgcagacagaccatacgaagcgcctg
gggacgctgaaaggcgggccggcggacgtgaagaaccacccgtacttccacggtgcgaac
tggagcaagctgtacgcccgctactaccccgcgccgatccctgtgcgggtgaagagccct
ggcgacacgagcaacttcgaaaagtacccggacagcccggtcgaccgcacgcctgcgctg
acgtcggcgcagcaggccgagttcaatggcttttag

DBGET integrated database retrieval system