KEGG   Leishmania mexicana: LMXM_36_0720Help
Entry
LMXM_36_0720      CDS       T02288                                 

Definition
putative mitogen-activated protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LMXM_36_0720
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LMXM_36_0720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 458 aa AA seqDB search
MSAEIESHILKKYEIQTQLGQGAYGIVWRALERKHNRVVALKKIYDAFQNSTDAQRTFRE
IMFLHRLHHPNIIRLLHVHRAFNDRDIYLVFEYMETDLHVVIRANILEGIHKQFIIYQLL
KTMKFLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSILSLEGEQASRPVLTDYIATR
WYRPPEILLGSTRYTKGVDMWSVGCILGELMLGKPMFPGRSTTNQLELICSVTGMPSAAD
VAATNSQFANAMLRDIHCAHRRTFAELLPSASADALNLIERLMCFNPNRRLSAAEALEHP
YVAAFHRPDDEPVAPEPITVSLPDSQRLPLAKYRDAIYEQIASLRRISTSTDHRHRAERH
GAGGTASRKTSASGGGGAAGGSRGGTGTSGATRPATSCSSSTAARAAPQRSVVKPTSTSG
VNESSSSKAYGRPGFRSVASTSSGLESRPVEREAAVRK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccgaaatcgagtcgcatattctgaagaagtatgagattcaaacacagctaggc
cagggtgcctacggcattgtgtggcgcgccctggagcgcaagcacaaccgcgtcgttgcg
ctcaagaaaatttacgatgccttccaaaactcgaccgatgcgcagcgcaccttccgcgag
atcatgttcctgcaccggctgcaccacccgaacatcatccggctgctgcatgtccatcgc
gccttcaacgatcgcgacatatacctggtcttcgaatacatggagaccgaccttcatgtg
gtgattagggcaaatatcttggagggaatccacaaacagtttatcatttaccagttgctc
aagacgatgaagtttctgcattctgccgagattcttcaccgtgacatgaagccaagcaat
ctgctcgtaaacagcgactgcacgatgaaggtggctgacttcggtctcgcgcgctctatc
ctgtcccttgagggcgagcaggcgtcgcggccggtgctaacggactacattgcgacacgg
tggtaccgcccgccggagattttgctcggctcgacacgatacactaagggcgtggatatg
tggtcagtgggctgcattcttggagagttgatgctgggcaagcccatgtttcccggccgc
tccaccacgaaccagctggagctgatttgcagcgtgacgggcatgccctccgcggcggat
gtggcagccaccaactcgcagttcgccaacgcgatgcttcgcgacattcactgcgcacac
cgacgcacgttcgctgagctgctgccaagcgcttccgcggatgcgctgaacctaattgag
cgccttatgtgtttcaacccaaaccgtcgcttgtctgccgccgaggctctggaacacccc
tacgtcgctgcctttcaccgtcctgacgacgaaccggtggcacccgaacccatcaccgtt
tctctccctgacagccagcgtttgcccttggccaagtacagagacgccatctacgagcaa
atcgcctcgctgcgccgtatctccacatccaccgatcatcggcatcgcgcggagcgacat
ggcgccggcggcaccgctagccgcaagacgtccgccagcggcggcggaggcgctgctggc
ggctctcgaggtggcaccgggacatctggggccacgcgacccgccacgagctgcagcagc
agcaccgccgcacgggcggctccgcagcgcagtgttgtaaagcccacctcgactagtgga
gtcaacgaatcatcatcttcgaaggcgtacgggcgtcccggcttccgctcggtagcgtct
accagctctggtctggaaagcagacccgtcgagcgtgaggcagcggtgcgcaaatga

DBGET integrated database retrieval system