KEGG   Leishmania mexicana: LMXM_36_0800Help
Entry
LMXM_36_0800      CDS       T02288                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
lmi  Leishmania mexicana
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:lmi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:lmi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 559 aa AA seqDB search
MSSSSSALDVPLVEVICSYPTREVLCAECPALLLLVYQHVVAELQAGRRAVDVFRGTSRQ
DHLSELLAVRSLSKLFERLYPLSQSCSLDESTAGSQFWGQVRVTLEAAWAPPHDAKARAL
LTQVRGQPRFHFCGPHDAETPGEGYPLHPVSLERALAASKRFLRTAMTCALDGSTDALAG
RQPELRAVLQLAHLVPDTPSTGAPPKKGVTPEGISFCMVSLQQRWWVLVNAALERVLLLT
RAVVNRNGSTSASSGVTKPLLWQLLAVLSVLDTAHYVFAFPEREQDLAAHHLLARLSEVG
LVYPLLSNDRKCFVLSPDFLHAIHWHASAPLSLTFNHHLVRSVSGAGVGDIRREDTDTII
TETNFRLYAYTDDADLLNILNQFAELEEIVNGNLHCYRVTRDSFAAAMRKGITAAQVLRF
LSLRAHPSMLRRHGEREESGDTAAPSSAGGVSSSLTFSAPHRRGAVPGTCGGTTAIDAVS
TIVVPQSFCDQMRMWESECHRVVFEHHVVLLRHMSMEQQKAVTAYLADAGEVDAIVHAER
GYMVIREEVFERLVAPLLG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgagctcttcggcattggacgtgccgcttgtagaagtcatctgcagctatcca
acccgcgaggtgctatgcgccgagtgtcccgcactgctgctgctcgtctaccagcacgtt
gtagcggagctgcaggcggggcgacgcgctgtggacgtgttccgtggcacctctcgacag
gaccatctgagcgaactgctcgctgtgcgctccttgtcgaagctgtttgagcgtctttac
ccgctgtcacagtcttgcagcctcgatgagagcactgcgggctcgcagttctgggggcag
gtacgggtgacgttggaggccgcgtgggccccgccgcacgacgccaaggcgcgtgccctt
cttacgcaggtacgcggccagccgcggttccacttttgcgggccgcacgacgccgagaca
cccggggagggctacccactgcaccccgtatccctggagcgggccttggcagcaagcaag
cgctttctccgcactgcgatgacctgcgcactggacgggtcaacggatgccctggcgggg
cggcaaccggaactgcgcgcggtgctgcagctggcccacctggttcccgatactccgtcg
acgggagcacctccgaagaaaggagtcacgccggaggggatcagcttctgcatggtgtcg
ctgcagcagcggtggtgggtgctggtgaacgcggcgctggagcgcgttctgctgctcact
cgcgctgtcgtgaacaggaacggtagcacgagcgccagcagcggcgtcacaaagccgctt
ctgtggcagctgctggctgtgctgtcggtgctagacactgcgcactacgtcttcgccttc
ccagagagggagcaggatctcgcggctcaccatcttctcgcacggctgtccgaggtcggt
ctggtgtaccccttactcagcaacgaccgcaagtgctttgtcttgagtcctgacttcctg
cacgccattcactggcacgcgagtgcgccgctctccctcaccttcaaccatcacctcgtg
cgaagcgttagcggtgccggcgtcggcgacatacggcgcgaggacaccgacaccatcatc
accgaaacgaacttccgtctgtacgcctacaccgacgatgccgacctgctcaacattttg
aaccagttcgcggagctggaggagattgtgaacgggaatctccactgctaccgggtgacg
cgggacagctttgctgccgcgatgcgcaagggcattactgccgcgcaggtgctacgcttt
ctttcgctgcgagcgcaccccagcatgcttcgccggcacggggagcgggaggagagcggt
gacacggcagcgccatcatccgctggcggggtctcctcttccttgactttttcagcgccc
catcgtcgcggggcggttccgggtacgtgtgggggcaccaccgccattgatgcggtgtcg
acgattgtggttccgcagtccttctgcgaccaaatgcgcatgtgggagagcgagtgtcac
cgcgtggtgtttgagcaccacgttgtcctgctacgccacatgtcaatggagcagcagaag
gcggtgacagcgtatttggccgatgcgggggaggtcgatgccattgtgcacgccgagcgc
ggctacatggtgattcgtgaggaggttttcgagcgccttgtcgcaccacttctggggtga

DBGET integrated database retrieval system