KEGG   Leishmania mexicana: LMXM_36_1630Help
Entry
LMXM_36_1630      CDS       T02288                                 

Definition
putative clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
lmi  Leishmania mexicana
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    LMXM_36_1630
Exosome [BR:lmi04147]
 Exosomal proteins
  Proteins found in most exosomes
   LMXM_36_1630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 1693 aa AA seqDB search
MDSPSISAEIFQLNSVSGGLTPGCVSFKNVTLESEKYVCVRDVQGDGTTSLVIVDLEKHE
SIRNNVKDAESCIMNPKTKILALRSGRNLQVFDVDASRRLKATLFHEDVVCWRWIDDRTL
GIVTARAVYHWSLDTAADDAPQHIFDRSADYDSSVQVLSYRSDEQKKWLVVTGVARDPAG
TMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCNVMCLAWNSPQQGGQVMIMELP
TGSKTDLSVLRRVYSVTIQPGDFPVSMNVSDRHKLLTVVTSRGSFVLMDIFTGTILTEQQ
FSSSVVFCGAADNKVGGVLCVNNQGAVMRIGPNDNGIISFVKNRMHNAELALRIASTANL
GGVDDLFKLQLDNFLRIGNVEEAVRMCLRAPGNSLRTREVLMRFMQMPQQPGQPPAISTY
FKIALAETNLNECESVELARAVVPKGGIGYVKQQFDEGKLTASEELGDLVQQADSNMALK
IFHQGNAHTKVLNLLLQRNETQKAVEYCKRANFSPDWRVIMNNFIRVAPQDAVNLGLMLY
REMGDRPVLTADEVVDMFVSAQQIQQATEFLLEILREHNDESTMELQTKLLEMNLKYSHP
SVADKIFVRKICQCYDGMKLAPLCERAGLHQHAIDCYIMAQKEDSDLNNLASIRRCLQQV
QNFNPEWLVDFFGKLNKQDSLKCLEDLCVNSRQNFKVIVQVATKYSDALGTADLIDLFLE
HSLYDVLYYYLGAVVPYTRDPEVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLK
NKKLTDMWPFINVCDQHNMLNEMVHYLVETGNESCIEQYLTRRSPGKTPQVVQALIECNV
SEEFTKNMLATVGTMCPIEELVDCVEEVGRLHLIKQWLEDRRSEKKTDKALYNALAKIYV
DIGQSPEQFLAENEYYDAEVVGKYCETRDPNLAYIAYCRGHCSDEMIGLCHRNGMYKQLA
RYLVKEQNLDLWASVLGQNSAQRQQLVESVQQIALPESESSEEVSATVRAFMNANLTEEL
TALLGQIVVHGRFRKNRFLENLLIMSAVRARKDKVMEYVTTLEDYDAKDIAHVASGAGMH
EIAFVVYTRHDMQKEAITVLLQDMNDVSRGRGFAQKTDTPVVWSVLGEYLVKQDEVHEGI
ECLIRAKNPDLVVEVASAAERTNQFGDLIKYLTMARQYSRAKDNKIDTALVITYAKTGRL
EELEEFLKETHNVKIGAIADKCFQDKLYESARVLYTVANNYARVASTEVMLGNLSAAVEA
AKKAKSIHTYKEVNLACIDAGDLKLAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVL
RNASGHQGAHMSIFTEMGVLLAKYRPEKLMEHVNMYAKKINTHKMITVCEQYHHWVVLRV
LHINNEDWLAATNSMMQHHADAFDHEIFKDAVSHLGASDLLYTAIGFYLKTHPEQLNDFL
FSIFKRVDPERVMAETKKVAPIHVIRTYLEAAQERNAKKVNETLNNLYIEEEDFKALRHS
VETYNNFDSEELSSRLEKMELFEFRKIALLLHRKNKRYSHAIAVAKENELFEEAIDTAAE
SGDSELVSSLLDYFVKDYPECFAACLYRCYDLLKPATVLQKAWLNQRTEMAMPYMIQVLQ
DYSSKIEKMEKSMMDAQTAAKDAARRAGPVQGPGSVPLMIEQGGGMPMNGMPMGAPQPMN
FGMPPQFGSGRPF
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atggactctccttcgatttctgcggagatctttcaactcaactcggtctcaggtgggctc
accccgggctgcgtctccttcaagaatgtcacgttagaaagcgagaagtatgtctgcgtc
cgcgatgttcagggcgacgggacgacgtcactcgtcatcgtcgatctagagaagcacgag
agcattcgaaacaacgtcaaggatgcagagtcgtgcatcatgaaccccaagacgaagatc
ctggcactacgcagcggccgcaatctgcaggtgttcgacgtggacgcctcgcgtcggctc
aaggcgacgctttttcatgaggatgttgtgtgctggcgctggatcgacgaccgcaccctc
ggcattgtgacggcaagggccgtctaccactggagcctcgacaccgctgccgacgacgcg
ccgcagcacatcttcgaccgaagcgcagactacgacagcagtgtgcaggtgctctcgtac
cgcagcgacgagcagaagaagtggctcgtcgtgacgggtgtggcgcgtgacccagcgggt
accatggtgggcaaggcgctgttgtacagcgtcgagaaccgcagcagtcgcgtgctcgac
ggtcatgcgtgctgcttcatctctacctccaccccatctgagcctcgcaagtgcaatgtg
atgtgcctcgcctggaacagcccgcagcaaggcggccaggtaatgatcatggagctgccg
accggctccaagacagatttgtcggtgctgcggcgggtttacagcgtaaccattcagccc
ggagacttcccggtcagcatgaacgtctcggaccgccacaagctgttgaccgtggtgacg
agccgcggcagctttgtgctgatggacatcttcaccgggaccatcctgacagagcagcag
ttttcgagctcggtggtgttttgcggcgcagccgacaataaggttggcggcgttttgtgc
gtcaacaaccagggcgccgtcatgcgcatcggcccaaacgacaacggcatcatcagcttt
gttaagaaccgcatgcacaacgccgagctggccctgcgcatcgcctccacggcgaatctc
ggcggcgtcgatgacctcttcaagctgcagctggacaacttcctgcgcattggcaacgtc
gaggaggccgtccgcatgtgcctgcgtgccccggggaactctctgcgcacccgcgaggtt
ctcatgcgtttcatgcaaatgccgcagcaaccgggccaaccgccggctatctcgacctac
ttcaagattgcgctggcggagacgaacctgaacgagtgcgagtctgtcgagcttgcgcgt
gcggtggtgccgaaaggcggcatcggctacgtgaagcagcagtttgacgagggaaagctg
accgcctccgaggagctcggcgacctggtgcagcaggcggactccaacatggcgctgaag
atcttccaccagggcaacgcccacaccaaggtgctgaacttgctgctgcagcgcaacgag
acgcagaaggcggtggagtactgcaagcgcgcgaacttctcgccggattggcgtgtcatc
atgaacaacttcatccgagttgcgccgcaggacgccgtcaaccttggcttgatgctatac
cgcgagatgggcgacaggccggtgctcaccgcggatgaggtggtggacatgtttgtgtcg
gcccagcagattcagcaggcgaccgagtttcttctggagatcctccgcgaacacaacgac
gagtcgacgatggagctgcaaacgaagctgctcgagatgaacctcaagtactcacatcca
tccgtcgccgataagatcttcgtccgcaagatctgccagtgctacgatggcatgaagctg
gcaccgctttgcgagcgagctggtctgcaccagcacgcgattgactgctacataatggct
cagaaggaggactccgatctcaataacctcgccagcatccgccgctgcctgcagcaggtg
cagaacttcaaccccgagtggctcgtggactttttcggcaagctcaacaaacaggacagc
ctcaagtgcctcgaggatctctgcgtcaactcgcgccagaacttcaaggttattgtgcag
gtggccaccaagtacagtgacgccctcggcaccgccgacctcatcgacctattcctcgag
cacagcctgtacgacgtgctctactactacctcggggccgtggtgccatacacgcgtgat
ccggaggtgcacttccgctacatcgaggccgctgctgagatgggccaaatgcaggagctg
gagcgcatgacccgcgagagcccgtgctacgacgccgagcggacgaagaactacctcaag
aacaagaaactgacggacatgtggccctttatcaacgtgtgcgatcagcacaacatgttg
aacgagatggtgcactacctggtggagacgggcaacgagagctgcatagagcagtacctg
acgcgccgaagccccggcaagacgccgcaggtggtgcaggccctcatcgagtgcaacgtg
agcgaggagttcaccaagaacatgctcgcgacggttgggacaatgtgccccattgaagaa
ctagttgactgtgtggaggaggtgggtcggctgcacctcatcaagcagtggctcgaggac
cgccgcagcgagaagaagacggacaaggcgctgtacaacgcgctggccaagatctacgtc
gacattggccagagccccgagcagttcctggcggaaaacgagtattacgatgcggaggtg
gtgggcaagtactgcgagacgcgcgaccccaacctggcgtacatcgcatattgccgcggc
cactgcagcgatgagatgatcggcctctgccaccgcaacggcatgtacaagcagctggcc
cgctacctggtgaaggagcagaaccttgatctatgggcgagcgtgctggggcagaactcg
gcgcagcggcagcagcttgttgagtcggtgcagcagatcgcgctgccggaaagtgagtcg
agcgaggaggtgagcgcgacggtgcgcgctttcatgaacgccaatctgacggaggagctc
accgcactgctgggccagattgtggtgcacggccgcttccgcaagaaccgcttcctcgag
aaccttctgatcatgtctgcggtgcgtgcccgcaaggacaaggtgatggagtacgtgacg
accctcgaggactacgacgccaaggatattgcgcacgtcgcctcgggtgccggcatgcat
gagatcgcgtttgtcgtatacacgcgccacgacatgcagaaggaggccatcacggtgctt
ctgcaggacatgaacgacgtttcgcgcggccgcggctttgcccaaaagacggacacgccc
gtcgtgtggtccgtgctaggtgagtacctggtgaagcaggacgaggtgcacgagggtatc
gagtgcctcattagggcgaagaaccccgatctcgttgtcgaggtggcgtctgcagcggag
cgcacgaaccagttcggcgacctcatcaagtacctcacgatggcccgccagtactcgcgc
gcaaaagataacaagattgacacggcgctcgtcatcacgtacgccaagacgggccgcctc
gaggagctggaggagttcctaaaggagacgcacaacgtcaagattggggccattgccgac
aagtgctttcaggacaagctgtacgagtcggcgcgcgtgctgtacaccgtggcgaacaac
tacgctcgcgtggcgtcgacggaggtgatgctgggtaacctctccgctgccgtggaggcg
gccaagaaggccaagtcgatccacacgtacaaggaggtcaacctggcatgcatcgatgct
ggggatctgaagctggctggcgtctgcgctgtcccagtggtgctcaaggcggaggaggta
agcggcatgtgcaaccgctacgaaagtcgcggcctctgggaggagctattctcggtgctc
aggaacgcctctggccatcagggcgcgcacatgtccatcttcaccgagatgggcgtcttg
ctggccaagtatcggcccgagaagctcatggagcacgtgaacatgtacgcgaagaagatc
aacacgcacaagatgatcaccgtctgcgagcagtatcaccactgggtcgtgctgcgtgtg
ctgcacatcaacaacgaggattggctggctgcgaccaactcgatgatgcagcaccacgcg
gacgccttcgaccatgaaatcttcaaggacgctgtgagccacctcggcgctagcgatctt
ctgtacaccgcgatcggcttctacctcaagacgcacccggagcaactgaacgacttcctg
ttctccatcttcaagcgcgtggatccggagcgggtgatggcggagacgaagaaggtggcg
ccgattcacgtgattcgcacctacctcgaggccgcgcaggagcgcaacgccaagaaggtg
aacgagaccctcaacaacctctacatcgaggaggaagacttcaaggcgctgcgccactcc
gtcgagacgtacaacaacttcgactcggaggagctgtcgtcgcggctagagaagatggag
ctctttgagttccgcaagatcgctcttctgctgcaccgcaagaacaagcgctattcgcac
gccatcgcggtggccaaggagaacgagttgttcgaggaggccatcgacacggcggccgag
agcggtgacagcgagctggtgagcagcctgctggactacttcgtgaaggactatcccgag
tgtttcgcagcgtgcctctacagatgctacgacctgctgaagccagcgacggtgctgcag
aaggcgtggctgaatcagcgaacggagatggcgatgccgtacatgattcaggtgcttcag
gactactcgagcaagatcgagaaaatggagaagtcgatgatggacgcacagaccgcggcg
aaggacgcggctcgtcgcgccggtccagtgcagggtcccggctccgtgccgctcatgatc
gagcagggtggcggcatgccgatgaacgggatgccgatgggtgcgccacagccgatgaac
tttggcatgccgcctcagttcggatctggccggcctttctag

DBGET integrated database retrieval system