KEGG   Leishmania mexicana: LMXM_36_2320Help
Entry
LMXM_36_2320      CDS       T02288                                 

Definition
(RefSeq) glucokinase 1-like protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmi  Leishmania mexicana
Pathway
lmi00010  Glycolysis / Gluconeogenesis
lmi00052  Galactose metabolism
lmi00500  Starch and sucrose metabolism
lmi00520  Amino sugar and nucleotide sugar metabolism
lmi00524  Neomycin, kanamycin and gentamicin biosynthesis
lmi01100  Metabolic pathways
lmi01110  Biosynthesis of secondary metabolites
lmi01130  Biosynthesis of antibiotics
lmi01200  Carbon metabolism
Module
lmi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMXM_36_2320
   00052 Galactose metabolism
    LMXM_36_2320
   00500 Starch and sucrose metabolism
    LMXM_36_2320
   00520 Amino sugar and nucleotide sugar metabolism
    LMXM_36_2320
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMXM_36_2320
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMXM_36_2320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 13448272
NCBI-ProteinID: XP_003874583
UniProt: E9AT09
Position
20
AA seq 411 aa AA seqDB search
MSLTVEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQGAQHDRSGLHIIYVRF
KVTKHDIRQLLEFFDAVLQHLKKNLPNRAAHFLRRVASGAVSVPGPVTNGQLGGPFNNLK
GIAQLADYPAELFPKGRSALLNDLEAGSYGVLALSNAGMLSDYFKVMWKGTQWDALSEGK
PVGSTIGRGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECGCLSMSWCANEDSKYVQAL
AGYMASKARVKGLGSTVAPIWEAATNGSGLEFNYAYEKEGPKASALLKSAHEVAKLAKGG
SDPAAMAAMDRLYKNLMGLTAETTMQFLPLTCVLMGDSIVSNSFYFDNPENVKRLKARIN
EHTMERQLKFLSRTTFLRQVRSVNINLLGCLGFGSQLSNPADQLAPTKSHL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcacagttgagatccaactcgagcagctggccccgaccatcaagggcgacgcc
tcctggtccaccggccccatctacgttgtgtgcgatgttggcggcacgaacgcgcgtgtc
ggctttgctcaaggggcgcagcatgacagaagcgggctgcacatcatctatgtccgcttc
aaggtgacgaagcacgacatccgccagctactggagtttttcgatgcggtgctgcaacac
ctgaagaagaacctgcccaaccgcgctgcccacttcctgcgtcgtgtcgcgtctggtgcc
gtgagtgtgccagggcctgtcaccaacggacagctcggcgggcccttcaacaacctgaag
ggcattgcgcagctggcggactacccagcggagctgttcccaaagggccgcagcgcgctt
ctgaacgatctggaggctggctcctatggcgtgctggcgctgagcaacgccggcatgctg
tccgactacttcaaggtcatgtggaagggcacgcagtgggatgcgctgtcggagggcaag
cccgtcggcagtaccatcggccgcggacgctgcatggtcgtggcccccggcaccggcgtc
ggctcttctctcatccactacgtgggtgtctcggacagctacgtcgtgctggcactggag
tgcggctgtttgtccatgtcttggtgcgccaacgaggactctaagtacgtgcaggcactt
gccggctacatggcatccaaggcgcgtgtgaagggcctgggctcgacggtggcccccatc
tgggaggctgcgacaaacggtagcgggttggagttcaactacgcgtacgagaaggagggg
ccgaaggcatccgccctcctcaagtccgctcacgaggtagccaagctcgccaaaggtggc
agcgacccggccgccatggcagccatggaccgtctctacaagaacctcatgggcctcacg
gctgagacgacgatgcagttcttgccgctgacgtgtgtgctgatgggcgacagcatcgtt
tccaacagcttctacttcgataacccagagaatgtgaagagactgaaggctcgcataaac
gagcacacgatggagcggcagttaaagttcttgagtcgcaccacattccttcgccaggtg
cgcagtgtgaacatcaacctgctgggctgccttggatttggtagccagctctccaatcca
gcagatcagttagcgccaaccaagtcacacttgtga

DBGET integrated database retrieval system