KEGG   Leishmania mexicana: LMXM_36_2320Help
Entry
LMXM_36_2320      CDS       T02288                                 

Definition
(RefSeq) glucokinase 1-like protein
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmi  Leishmania mexicana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMXM_36_2320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMXM_36_2320
   00052 Galactose metabolism
    LMXM_36_2320
   00500 Starch and sucrose metabolism
    LMXM_36_2320
   00520 Amino sugar and nucleotide sugar metabolism
    LMXM_36_2320
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    LMXM_36_2320
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMXM_36_2320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 411 aa AA seqDB search
MSLTVEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQGAQHDRSGLHIIYVRF
KVTKHDIRQLLEFFDAVLQHLKKNLPNRAAHFLRRVASGAVSVPGPVTNGQLGGPFNNLK
GIAQLADYPAELFPKGRSALLNDLEAGSYGVLALSNAGMLSDYFKVMWKGTQWDALSEGK
PVGSTIGRGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECGCLSMSWCANEDSKYVQAL
AGYMASKARVKGLGSTVAPIWEAATNGSGLEFNYAYEKEGPKASALLKSAHEVAKLAKGG
SDPAAMAAMDRLYKNLMGLTAETTMQFLPLTCVLMGDSIVSNSFYFDNPENVKRLKARIN
EHTMERQLKFLSRTTFLRQVRSVNINLLGCLGFGSQLSNPADQLAPTKSHL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcacagttgagatccaactcgagcagctggccccgaccatcaagggcgacgcc
tcctggtccaccggccccatctacgttgtgtgcgatgttggcggcacgaacgcgcgtgtc
ggctttgctcaaggggcgcagcatgacagaagcgggctgcacatcatctatgtccgcttc
aaggtgacgaagcacgacatccgccagctactggagtttttcgatgcggtgctgcaacac
ctgaagaagaacctgcccaaccgcgctgcccacttcctgcgtcgtgtcgcgtctggtgcc
gtgagtgtgccagggcctgtcaccaacggacagctcggcgggcccttcaacaacctgaag
ggcattgcgcagctggcggactacccagcggagctgttcccaaagggccgcagcgcgctt
ctgaacgatctggaggctggctcctatggcgtgctggcgctgagcaacgccggcatgctg
tccgactacttcaaggtcatgtggaagggcacgcagtgggatgcgctgtcggagggcaag
cccgtcggcagtaccatcggccgcggacgctgcatggtcgtggcccccggcaccggcgtc
ggctcttctctcatccactacgtgggtgtctcggacagctacgtcgtgctggcactggag
tgcggctgtttgtccatgtcttggtgcgccaacgaggactctaagtacgtgcaggcactt
gccggctacatggcatccaaggcgcgtgtgaagggcctgggctcgacggtggcccccatc
tgggaggctgcgacaaacggtagcgggttggagttcaactacgcgtacgagaaggagggg
ccgaaggcatccgccctcctcaagtccgctcacgaggtagccaagctcgccaaaggtggc
agcgacccggccgccatggcagccatggaccgtctctacaagaacctcatgggcctcacg
gctgagacgacgatgcagttcttgccgctgacgtgtgtgctgatgggcgacagcatcgtt
tccaacagcttctacttcgataacccagagaatgtgaagagactgaaggctcgcataaac
gagcacacgatggagcggcagttaaagttcttgagtcgcaccacattccttcgccaggtg
cgcagtgtgaacatcaacctgctgggctgccttggatttggtagccagctctccaatcca
gcagatcagttagcgccaaccaagtcacacttgtga

DBGET integrated database retrieval system