KEGG   Leishmania mexicana: LMXM_36_2660Help
Entry
LMXM_36_2660      CDS       T02288                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase precursor,putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmi  Leishmania mexicana
Pathway
lmi00010  Glycolysis / Gluconeogenesis
lmi00020  Citrate cycle (TCA cycle)
lmi00620  Pyruvate metabolism
lmi01100  Metabolic pathways
lmi01110  Biosynthesis of secondary metabolites
lmi01130  Biosynthesis of antibiotics
lmi01200  Carbon metabolism
Module
lmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMXM_36_2660
   00020 Citrate cycle (TCA cycle)
    LMXM_36_2660
   00620 Pyruvate metabolism
    LMXM_36_2660
Enzymes [BR:lmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMXM_36_2660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 13448045
NCBI-ProteinID: XP_003874617
UniProt: E9AT43
Position
20
AA seq 466 aa AA seqDB search
MFRCRAASKLATLATLRFLTITPIPMPALSPTMEKGKITEWCKQPGDAIRPGDTFCNIET
DKAVVSYDNATEEGFFARVITSAGEETVVGQTVCLIVDEKEGIHSDEVKNWKPEAEEAPA
AAAEEAPAAPAAAAPVAAAPVAASGDRVKASPYARKMAAEKNVPLSGIKGTGGGVGRITS
RDVAAAVASGAVSSAAQVAAPAKTAAAAAAAALTAPAKPAAAKGTPPANPNFTDIPVTTM
RSVIAKRLHQSKNMEIPHYYLFDDCRVDNMLALIKQLNAKGNGEYKITVNDYIVKAVARA
TTLVPEVNSSWQGDFIRQYATVDVSVAVATPTGLITPIIRNAQAKGLVEISKETKALAKK
AREGTLQPSEFQGGTCSVSNLGATGIPGFTAIINPPQAMILAVGSAKPRAEIVKNGETGE
FEMTGRVENAVNFAASFDHRIVDGALGAKWFQHFHDAMENPLSLLL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttccgctgccgtgctgcctcaaagctggccacgctggccacccttcgcttcctcacc
atcacccccattcccatgcccgcgctctcccccactatggagaagggcaagatcacggag
tggtgcaagcagcctggtgacgccattcgccccggcgacaccttctgcaacatcgagacc
gataaggctgtcgtatcgtacgataatgcaaccgaagagggcttcttcgcccgcgtcatc
acttctgctggcgaggagacggtcgtgggtcagacagtgtgcctcattgtcgacgagaag
gagggtatccactccgacgaggtcaagaactggaagcctgaggccgaggaggcgccagct
gcggctgccgaggaggctcccgctgcccctgccgctgctgcccctgtggctgctgcccct
gtagcggcgtctggtgaccgcgtgaaggcatcgccgtacgctcgcaagatggctgcagag
aagaacgtgccactgagcggcatcaagggaaccggtggtggtgtgggtcgcatcacgtcc
agggacgtggcggctgctgtggcaagcggcgccgtcagctcggctgcacaggtggctgca
ccggccaagactgctgctgctgctgctgctgcggcactgaccgcccccgcgaagcccgcg
gcagccaagggaacgccgccagcgaaccccaacttcaccgacattccggtgacgacgatg
cgatctgtcatcgcgaagcgcctgcaccagtccaagaacatggaaattccgcactactac
ctcttcgacgactgccgcgtcgacaacatgctggccctcatcaagcagctgaacgcgaag
ggtaacggcgagtacaagatcaccgtgaacgactacatcgtcaaggcggtagcgcgcgcc
accactttggtgccggaggtgaactcctcctggcaaggcgacttcatccgccagtacgcc
accgtcgacgtctcggttgctgtggccacgccgactggcctcattactccgatcatccgc
aacgcgcaggcgaagggtctcgtagaaatatcgaaagagacgaaggctctagcgaagaag
gcgcgcgaaggtacgctgcagcccagcgaattccagggtggcacgtgctccgtgtcgaac
ctcggtgccacgggcatccccggcttcacagccatcatcaatcccccgcaggcgatgatt
ctcgctgtcggctccgccaagccgcgcgctgagattgtgaagaacggggagacaggcgag
tttgagatgactggcagggtcgagaacgccgtgaactttgcggcgtcctttgaccaccgc
atcgtcgatggcgcgctcggcgccaagtggttccagcacttccatgacgccatggagaac
ccgctgtcacttctgctgtag

DBGET integrated database retrieval system