KEGG   Leishmania mexicana: LMXM_36_6320Help
Entry
LMXM_36_6320      CDS       T02288                                 

Definition
putative phosphatidylinositol 3 kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
lmi  Leishmania mexicana
Brite
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LMXM_36_6320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 2613 aa AA seqDB search
MESKGGVGSSNGSGGTSSNRHPLIGQLRPIFQELESATPQTLPSIILKLEYVIEEEKDAL
FHRNSIKSYTANARTFPNWLNAQLRHLFEHPQTHMAGVQVLRALLPVEYVELNEMTKLFS
ELLVRCVLETADYKTALEGGEVWGLLLNNGSSVAEGIIINCLQFSLALLMRGGNDETFLR
EDVSHHSVDSEATVRSAMSPLVDSSRQGENAALLDDDRFPKATKLSGCIFIQQLVRRVPS
TIAPHVNSILECLRRAILDSNKLVRVSGGDALFHTLAISYRSTDQKFYSHWQNTFLEDAE
RSVMYGSDVVLHGCLLAFNAVLSATASREAEGRAVGFSNQGRKHILQFWTFINDNLVSTS
HNSDVRAEVLNALPLLAQYDSTTFKELSVKHVRALAAVVFVGTEGKDERAMVFQVLARLF
TVLPSLVVPFLDFMMKYIEASLTPQPLRDRCPEAVTCFATLSSVEPNAVRPFLRPLLGPL
FAGSVTEHFARDVAKICTAFPELRSTCLSKVLEATKEQLLRMRNRPRHTSASGETDHCAI
VRSLNSLGRLDFTGYSTLQFLCDAVIRYVSDPHEEVRRSAIDLCFKLTLSGCSQSPCERT
AVGVVIHRGREHVGLVNTVIRKLVSAAVADTESDIRLHTLEHLSTEFDYSLALQDICTAL
FPALHDHHQNRIAAVRLLGRLSSRNPSCILPMLRCVMVQCIMDIQLFHEPKRQEQAAVVL
SAVVESAPAMARPYISSLLQDCVTRLQEENKPVPVITALLSLVGKLARYAENDDVAVVAA
IRPCVIRHILDSSSIQKKIEAIRALGDIIRTTKDVDVYETNPELLRVLLSALHGGFKETW
PVRVDVLKLMGIIGAVDPVRAKEITRHLRDGSLSSSGAAAPAALQLFSSRGEEAIAQNVV
KNVLGVLQLPSLSDDQCLCAVQVIANTLSLKEAASGCLTPMYRDILHTVIQQITLQAKIR
ENLFGVMTHIVYLYGQHIRPYLDELISTCVGFLPAAERGVLVEILCLLREGRRSLREEFS
PSLSLVLPPLIQTVQADAAHSSEPVFAFLIEMGHLLDDHLHNVVPCVCEVASNPAYPVAC
RAAAADAIRHFALRLPRLVFHASRCVHCLCRVLREMESHPLLFEQQPGASADAAQRRPAA
DLAAGGDTTASDVRSFVAVTLDAVRVVSRNLGSDFEKYTPLVFPLLDGYGQDGQDVKAFS
LSTLRTSGRVAAPENAQAQEEEVAARYRVNTQQLAQRRKAALEDNFAQLRSILVARDRET
EEEWNLWLKQLAVELLRSSPSNAHGFAFALAQLHEPFARQMLHSAFAVCYAEMEPRTKET
VRALLGNVLRSDRVPSEVLQELLNLSEYMERLEMRFNPKEGSHSTYAGLLFDLKTLMESS
ERCNLYAKALHYVEIQFYEATYEYERNVMRGHVHPLPPEKWSKLVQWCEKSIYLCNLLGL
RESAEGMLKYIQRNFSFLTGKPPSELPFMMDAQLLEKLQWWSQSLRAYEKGLQAEPNKFS
NMVGLMRSLDNLGDYGRLLESWKLFHPRITRKEASELAPYGAHAAWLLRCWDDMEKITAY
MTDDGYVGTTAVFYRAVLATHKLQFHDAVPVIQNCRKRLDSTLSALVAESYDRAYGLFVG
IQQLSELEEFAFVADNPQGLNHWQELWEKRLAAMAYEGWPGTLANHTLVIPLAQELEMWL
RFVSLSRVHGRDRTSRDILFELLGRQTIAAALEQPRLPQPPIALAACQHFYDINEREKAV
ELLETYLKKMDQASPSLLGIGGGQASLAMCHAKLASWLFTVAKKKRQNVDAHYREYIRHH
LEKATSLDSTNGTIWHTWARFNHDLVTHRSRGAASEVRRDEHVKHIVAAMDGYVRSVSCS
QELEDMLGFLSLWFIHAALPQVQENAALQAEILQVSPTVWLKVLPQIIARLHSRDAVVSE
SVFQLLTIVAKAHPQALLYNLNVTLNSSVRGTESNTTEQMERKQAAQRLLGRIKEMHNHG
RTMVKDAALVCQELVRCAVLWTELWFDELERAWFQWGRDKNAHNVFLALQPLLEQLSHPN
TLAESHFVAEFGELLGGACEYVEKAASTGNNVYMEDAWNRFKTAVKRMDEQINGMTSLAL
QLVSPRLMQSGKDLSLVVPGQYNEAGVYPRIASFQTTLRVMNSKQHPRRLYMTGTDGVLY
KFLLKGHEDLRLDERVMQLLAFVNTLLEKHSAIQRRDCMIQVFSVTPLSENAGLVGWVDN
CDTLHQLIKDYRVHSKYLSIEMNLMLSFNVDLDRLQVIQHVEPFEFALEQTEGADLANSL
WMRAPSAESWLDRRTTYVCSLATMSMVGHILGLGDRHPSNLMIHSFSGRVVHIDFGDCFD
VAQNRSAFPEKVPFRLTRMLVKAMEMGGIDGLFRHGCITVMGVLREEGSSILALLEAFVH
DPLVSWWRDESEDGTTASSAVASAAQSSSMPSAVPAAALGHYSQRAAYTAIGESFHKSRT
AFACRTPASRSLAPRGRSLRAPQASIVSSPSAPPALVSDPSSDILSNMSVNQTSEAKKVV
NRIREKLEGREFAASQLQASASAHAADGVGVAMKGPADEGPMTSVRLGSAASAAPMTSGE
DGLSVQAQVSRLISEATSNENLCVHFQGWCPFW
NT seq 7842 nt NT seq  +upstreamnt  +downstreamnt
atggagtctaaaggtggcgtaggcagtagcaatggcagcggcggcacgagcagcaatcga
cacccgctgattgggcagctgcggcccatctttcaagagctagagtcggccacgccgcag
acgctcccctccatcatcctcaagctagagtacgtgattgaggaagaaaaggacgctttg
tttcaccgcaactccatcaagtcctatacggccaatgcacgcacgttccccaactggctg
aatgcgcagctgcgacacctgtttgagcatccgcagacgcacatggccggcgtgcaggtg
ctacgggcgctgctgccagtggagtacgtggagctgaatgagatgacgaagctcttttcg
gagctgctggtgcgctgcgtactggagacggcggactacaagacagccctggagggggga
gaggtgtggggtttgctactcaacaatggcagcagtgtagccgaggggatcatcatcaac
tgcttacagttttcgttagccttgctgatgcgcggagggaacgatgagacattcttgcgt
gaagatgtgagccatcacagcgtcgacagcgaagcgacggttcgatcggccatgtccccc
ttggtggactcttcgcggcaaggtgagaatgccgccctcctggatgacgatcggttcccc
aaggcaacgaagctgtcggggtgcatcttcattcagcagctggtgcgccgcgtgccatcg
acgatcgcgccgcacgtgaacagcattcttgagtgcctgcgccgcgccatcctcgactcc
aacaagcttgtgcgcgtgagcggcggcgatgcactctttcatacgttggctatttcctat
cgctccaccgaccaaaaattctacagccactggcagaacacatttctcgaagatgctgag
cggagcgtcatgtacggcagcgacgtcgtcttacatggctgcctgctggccttcaatgcc
gtactctccgcgacggcatcgcgtgaggcggaagggcgagcagtcggcttctccaaccaa
gggcgaaagcacattctgcagttctggacgtttatcaacgacaaccttgtgagcacctcg
cacaacagcgacgtgcgcgccgaggtgctcaacgcactaccgctgttggctcagtacgac
agcactaccttcaaagagttatcggtgaagcacgtgcgcgcgctggcggcggtggtgttt
gtcggcacggaaggcaaggatgagcgggcaatggtgtttcaggtgctcgcgcggctcttc
acggtgctgccaagccttgttgtgccgttcttggacttcatgatgaagtacatcgaggca
tcgctgacaccgcaacctctccgtgaccgctgccctgaggctgtgacatgctttgccacg
ctctctagcgtagagccgaatgcagtacgccccttcctgcggcccctgctcggaccccta
ttcgctgggtcggtgacggagcactttgcgcgcgacgtggcgaagatctgcacggccttc
ccagagttgcggtcgacgtgcttgtcgaaggtactagaggcaacaaaggaacagttgcta
cgcatgcgtaaccgcccccgacacaccagcgcgtccggtgagacggaccactgtgctatc
gtacgcagcctcaattccctgggtcgcctcgactttactggatactcgacgttgcagttc
ttgtgcgacgctgttattcgatacgtttcggacccacacgaggaggtgcgccggagcgcg
atcgacctgtgcttcaagctgaccctctccggctgctctcagtcgccatgcgagcgcaca
gccgtcggtgtcgtgattcaccgcggtcgggagcacgtgggcctggtgaacaccgtcatc
cggaaactggttagcgcggctgttgcggacaccgaaagcgatatccgcctgcacacgctg
gagcacctgagcacggagtttgactactcgctggctctacaggacatctgcacagcactg
ttccctgccctgcacgaccaccaccagaaccgcatcgcagccgtgcgtcttctgggccgc
ctttccagtcgcaacccgtcatgcatccttcctatgctgcgttgcgtgatggtgcagtgc
attatggacattcagctctttcacgagccgaagcggcaggagcaggctgcggtggtgctg
agcgcggtggtggagtccgctcctgcgatggcacgcccgtacatctcgtctctgctgcaa
gactgcgtaacgcggctgcaggaagagaacaagcctgttccggtgatcacggcgctcttg
tcgcttgtcgggaagctcgcgcggtacgcggagaacgacgacgtggctgtggtggccgcc
attcgaccgtgtgttattcggcacatcctcgactcgtccagcatccagaaaaaaatcgag
gccattcgcgctttgggagatatcatccgcaccacaaaggatgtcgacgtttacgagaca
aatcccgagctgctgcgcgttcttctctccgctctccacggcggcttcaaagaaacgtgg
ccggtgcgagtggatgtgttgaaactgatgggaattattggcgccgtcgatcctgttcgt
gccaaggagatcacacgtcacttgcgagatggaagtctgagcagcagtggcgcggctgcc
cctgctgcgttgcagcttttttcctctcgcggggaagaggcgatcgcgcagaatgtcgtc
aagaacgtactcggcgtcctgcagctgccaagcttatcggatgaccagtgcctctgcgca
gtgcaggtgatcgcaaacacgctgtcgctcaaggaggcggcgagcgggtgtctgaccccg
atgtatcgcgacattctacatactgttattcagcaaatcactcttcaggctaagatacgc
gagaacctgttcggggtgatgacgcatatcgtgtacctttacggccagcacattcgccca
tacctggacgagctcattagcacgtgcgtcggcttccttcctgctgcggagcgcggcgtc
cttgtggagatactgtgtctgctgagggaggggcgccgctcgctccgtgaagagttcagt
ccttcgctctcgctggtgctgcctccgctcatccagacggtgcaggccgacgccgcgcac
tccagcgagcctgtcttcgccttcctcatagaaatggggcatttgcttgacgaccacctc
cacaacgtcgtgccctgcgtctgcgaggtggcaagtaatcctgcttatccggtggcctgc
cgtgcggcggccgcggacgccattcgccactttgctcttcgactgccacgccttgtgttt
cacgcgtcgcgctgcgtgcactgtctttgccgggtgctgagggagatggagtcgcatccc
ctgctgtttgagcagcagccaggagcatccgcggacgcggcccagcgccgccctgctgcc
gacctagcggctggcggagacacgacggcttcagacgtgcgcagtttcgtcgccgttacc
ctggacgcagtgcgcgtcgtcagccgcaacctcggcagtgacttcgagaaatacaccccc
ctggtgttcccactgctggacggctacggccaggacgggcaggatgtgaaggcattctcg
ctcagcactctgcgcacgagtggccgcgtggcggcgcctgagaacgctcaggcgcaagag
gaggaggtcgctgcccggtatcgcgtcaacactcagcagctggctcagcggcgcaaggcc
gcgctggaggacaactttgcgcagctgcgcagcatccttgtcgcgcgcgatcgggagacc
gaggaagagtggaacttgtggttgaagcagctggcagtggagctgctacggtcgagtccg
tcgaacgcgcatggctttgcctttgccctagctcagctgcacgagccctttgcgcggcaa
atgctgcactccgccttcgccgtatgctacgcggaaatggagccgcgcaccaaggagacg
gttcgcgctcttctcggcaacgtactccgcagcgaccgcgtgccgtccgaggtgctgcag
gagctgctgaacctgtccgagtacatggagcgactggagatgcgctttaacccaaaggaa
ggctcgcacagcacgtatgccgggctgcttttcgacttgaagacgttgatggagagcagc
gagcgctgcaacttgtacgccaaggcgctgcactacgtcgagattcagttctacgaggcg
acgtacgagtacgagcgcaacgtgatgcgcggccacgtgcacccgctgccgccggagaag
tggagtaagcttgtacagtggtgcgagaagagcatttacctgtgcaacctgctgggactg
cgcgagagcgcggaggggatgctcaagtacatccagcgcaatttttcgttcctgaccggc
aagcctccgtcagagttgccctttatgatggacgcgcagctcctcgagaagctgcagtgg
tggtctcagagtttgcgggcgtatgagaagggcctgcaggcggagccgaacaagttcagc
aacatggttggcctcatgcgctccctcgacaacctcggcgactacggtcggctgctggag
tcgtggaagctcttccacccccgcatcacacgtaaggaggcctctgagctggctccgtat
ggcgcccacgcagcgtggctgctgcggtgctgggacgacatggaaaagatcaccgcttac
atgacagatgacggctacgttggcacgaccgctgtcttttaccgcgctgtgctcgccacc
cacaagcttcagttccacgacgccgtaccggtgattcaaaactgccgcaaacgactcgac
tcgacgctgtcggcactcgtggcagaaagctacgaccgcgcctacggtctgtttgttgga
atccagcagctgagtgagctggaggagttcgcgtttgtcgcggacaatccgcagggcctc
aaccactggcaggagctgtgggagaagcggctggctgccatggcctacgaaggctggccc
ggcacgcttgcgaaccacacgcttgtcatcccactggcgcaggagctggagatgtggctt
cggttcgtgtcgctgtcgcgcgtgcacggtcgagaccgcacatcgcgcgacatcctgttc
gagctgctgggcaggcagaccattgcggccgcactggagcagccgcggctgccgcaacct
ccaattgccctcgccgcctgccagcacttctacgacatcaacgagcgcgaaaaggcggtc
gagctgcttgaaacctacctgaagaagatggaccaggcatccccctcgctgctgggcatc
ggtgggggtcaagcgagcctggccatgtgccatgcaaagttggcgagctggctcttcacc
gtggcgaagaagaagcggcagaacgttgatgcgcactaccgcgagtacatccgtcaccac
cttgagaaagcgaccagcctcgacagcaccaacggcacgatttggcacacgtgggcgcgg
ttcaaccacgatcttgtcacacaccgctcccgcggtgcggcgagcgaggttcgccgcgac
gagcacgttaaacacatcgtggctgccatggacggctacgtgcggagcgtgtcctgctcg
caggagctcgaagacatgctagggtttctctccttgtggttcattcatgccgcgctgccg
caggtgcaggagaatgcggcgctgcaggcggagattcttcaggtgagcccgacggtgtgg
cttaaggttcttccccaaatcatcgcccgtttgcactcgcgcgacgccgttgtgtccgag
tccgtctttcagctgctcaccattgtcgccaaggcgcacccgcaggcgctcctgtacaac
ctcaatgtcacgctgaactccagcgtgcggggtacagagagcaacacgacggagcagatg
gagcgcaagcaggcggcgcagcggttgctcggccgcatcaaggagatgcacaaccatggt
cgaacaatggtcaaggacgccgcccttgtctgccaggagctcgtgcgttgcgcagtgctc
tggacggagctgtggtttgacgagcttgagcgagcgtggtttcagtgggggcgcgacaag
aacgcccacaacgtctttcttgcccttcagccgctgcttgagcagctgtcgcaccccaac
accctcgccgagtcgcactttgtggccgagttcggtgagctacttggtggcgcctgcgag
tacgtggaaaaggccgcgtcgaccggcaacaacgtctacatggaggatgcgtggaaccgc
ttcaagacggctgtgaagcggatggatgagcagatcaacggtatgacctcacttgccctt
cagctcgtgagcccgcgtctgatgcaaagcggcaaggacctgtcgctggtggtgccaggg
cagtacaacgaggccggcgtgtacccgcgaatcgcctccttccaaaccacgttgagggtg
atgaactccaagcaacacccgcgtcgtctttatatgaccggcacggatggcgtcttgtac
aagtttctcctcaagggtcacgaagatctgcggctcgacgagcgcgtcatgcagctgctg
gcattcgtgaacacactgctggaaaagcactcggctatccagcgccgtgactgcatgatc
caggtattctctgtcacccccctcagcgagaatgcggggctggttgggtgggtcgacaac
tgcgacacactgcaccaactcattaaggactaccgcgtgcactccaagtacctctcgatt
gagatgaacctgatgctgagcttcaacgtcgacctggaccggcttcaggtgattcaacat
gtcgaaccgttcgagtttgcactggagcagacggagggcgccgacctcgccaactcgctc
tggatgcgcgcgccaagcgctgagtcgtggttggaccggcgcaccacttatgtctgttcg
cttgccaccatgtccatggttggtcacattttgggccttggcgaccgtcacccgtcgaac
ctgatgatccactcctttagtggtcgcgtcgtgcacatcgactttggcgactgcttcgac
gtggcgcaaaaccgcagcgcgttcccagagaaagtgccattccggctgactcgaatgctg
gtcaaggccatggagatgggcggcatcgacggactcttccgccacggctgcatcacggtg
atgggtgtgctgcgcgaggagggtagcagcattctggctctgctggaggcttttgtgcac
gacccgcttgtgtcgtggtggcgcgacgagtcggaagacgggacgaccgcatcttctgcc
gtcgcgtcggcggcgcaaagcagcagcatgccgtctgccgttccggctgcggcactcgga
cactattcgcagcgcgccgcctacacggccattggtgagtcctttcacaagtctcgcacc
gcctttgcttgtcgcacgccggcgtcgcgctcgttggcgccgcgtggtcgctccttgcgc
gcaccacaggcttcgatcgtctccagcccctctgcgccgcctgccctcgtctccgatccg
tcgtcagacattttaagcaacatgtcagtcaatcaaaccagcgaggcaaagaaagtggtc
aatcgcatccgcgaaaagctcgagggccgcgagtttgccgcgtcgcagctccaagccagt
gcctcggcgcacgcggcagatggcgtaggtgtggccatgaagggaccagcggacgagggc
ccaatgacgagtgttcgcttgggcagtgctgcgtctgcagcaccaatgacgagcggcgaa
gacgggctttctgttcaggcgcaggtgagtcggctcatctcggaggccacctccaacgag
aacctgtgcgtccacttccaaggctggtgcccgttttggtga

DBGET integrated database retrieval system