KEGG   Leishmania mexicana: LMXM_36_6550Help
Entry
LMXM_36_6550      CDS       T02288                                 

Definition
protein-l-isoaspartate o-methyltransferase,putative
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LMXM_36_6550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 259 aa AA seqDB search
MAWHCSSTTNAGMVAALQREGLIKTPEVIEVMRRVDRGWFVRNPKDAYRDQPLPIGFGVT
ISAPHMHAIMLELVCPSVLRHKNLDRARCQSLRLLDIGSGSGYMTAAFAALCEAVWRDSE
PPTFEVVGIEHVQELQKQSKRVLESHFPDWIREHRVTLLHGDGRKPRSIAGLGEEKGECF
DVIHVGATAPKTLVPEYLSLLRCGGTLVIPVGSPAEVQELQVFTKGDEGAFTMRRACHVQ
FVPLTSLHAQLDGDVATRT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcattgctcgtcaacgacgaatgcggggatggtggctgcactgcagcgcgag
ggtctcatcaaaacacccgaagtgattgaggtgatgcgccgtgtggaccgtggctggttc
gtgcgcaaccccaaggatgcttaccgtgatcagcctctgcccattggtttcggcgtcacc
atcagcgcgccacacatgcatgctatcatgttggagctggtttgcccgtctgtgctgcgc
cacaagaatctggaccgagcccgttgccaatcgctgcgactgctggacatcggtagtgga
agcggctacatgacggctgcctttgccgcgctgtgtgaggcggtttggcgagacagtgag
ccgcctacctttgaggtcgtcggtatcgagcacgtgcaggagctccagaagcagtcaaag
cgtgtcctcgagtcgcacttccctgactggatccgcgagcaccgcgtcacgctgctgcat
ggagacggacgaaagcctcgctccatcgcgggtctcggagaggagaaaggtgaatgcttc
gacgtcatacacgtcggcgccaccgcgccgaagactctcgtgcccgagtacctaagcctt
ctccggtgcggtggtaccctggtgatccccgttggtagcccggccgaggtgcaggagtta
caggtgttcacgaagggcgatgaaggcgctttcacgatgcgacgggcgtgtcacgtgcag
tttgtgccgcttacatctctacatgcccagctcgatggcgacgtggcgacgcgcacgtaa

DBGET integrated database retrieval system