KEGG   Listeria monocytogenes J0161: LMOG_00058Help
Entry
LMOG_00058        CDS       T01987                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmj01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lmj00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1673027..1673785)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKEVEVAKMPLEQVAEKRKTYSFYEFLKANTNTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVGIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEKLITLFEQALALDLEVLVEVHDQEELAVAQKIGAQLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYDAVLVGEALMREAT
PEVAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagaagtagaagttgcaaaaatgccctta
gaacaagtagcagaaaaacggaaaacttattcgttttatgaatttttaaaagcaaataca
aacacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccagttctgcaagccaagtcttatcaagccgcgggtgcgggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtgggaattcctgtactctgtaaagatttcattattagtgaaaaacaattgatt
cgcgctcgaaatgcgggagcgacggttgtgttgttaattatttcggcacttacagaagag
aagctaatcaccctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccaggaagaattagctgttgctcaaaaaatcggagctcaactcattggtgtaaac
aatcggaatttgcacacatttgaagtggatattgcagtaagcgaaagactggcgagtgat
ttttcgtcggatgcttgttttataagcgaatcaggttttcgaacagcagaagatgtggct
cgcgtgagtcaaaaatatgatgcggtactcgttggagaagcgttaatgcgagaagcgact
ccagaagtggcagcgaagagtttgaaggtgacacgatga

DBGET integrated database retrieval system