KEGG   Listeria monocytogenes J0161: LMOG_00370Help
Entry
LMOG_00370        CDS       T01987                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOG_00370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_00370
   00052 Galactose metabolism
    LMOG_00370
   00500 Starch and sucrose metabolism
    LMOG_00370
   00520 Amino sugar and nucleotide sugar metabolism
    LMOG_00370
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOG_00370
   00524 Butirosin and neomycin biosynthesis
    LMOG_00370
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMOG_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1366847..1367815
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEFTGKSALKDAIDNNETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFEMMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaggaaaaatggactattgatacaaatattgaagataaaggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacagacttacaacta
gataatgatattttttacggtattggtatgggaactccgggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacctagggtgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttgaaaatcatattagataatgatgcgaatgttgccgctctt
ggcgaacgctggaaaggcgcaggtgaaggtggcgcgaatgttgttttcgtaacacttgga
acaggcgttggtggtggtatttttgcggaaggtaaaattttacatggcatccgcggggca
gcaggcgaaataggccacgtaacagtagttcctgagaatggttacgattgtacttgtggt
aaaaaaggatgtctagaaactgtcgcatcagcaacaggaattgttcgagtagcgaaagat
ttagcaaaagagtttactggtaaatctgctcttaaagatgcaatagacaacaacgaaacg
attacctccaaattgatttttgaactaggtgcggaagatgatgcattagcgaatgaaaca
attgataaaatttctttctatttggctttagcgcttagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggagtttcagcagcaggagatcaattattgacaccg
gttaaaacttattttgaaatgatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgatgcagggataattggagctgcgtggttagcactaccaagt
gaagattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system