KEGG   Listeria monocytogenes J0161: LMOG_00458Help
Entry
LMOG_00458        CDS       T01987                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00330  Arginine and proline metabolism
lmj00332  Carbapenem biosynthesis
lmj01100  Metabolic pathways
lmj01130  Biosynthesis of antibiotics
lmj01230  Biosynthesis of amino acids
Module
lmj_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LMOG_00458
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LMOG_00458
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LMOG_00458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AEO03343
Position
complement(1284996..1285826)
Genome map
AA seq 276 aa AA seqDB search
MRESLKNSKRLVIKVGTSTLMYGNGHINLRTIEKLAMVLSDLRNEGKEVILVSSGAIGVG
CHKLQLPVRPTSIPEQQAVASVGQSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPISREN
VMNTLESLLERGIIPIVNENDTVAVEELEHVTKYGDNDLLSAIVAKLVQADLLIMLSDID
GFYGSNPSTDPDAVMFSEINQITPEIEALAGGKGSKFGTGGMLTKLSAASYCMNANQKMI
LTNGKNPTIIFDIMQGEQIGTLFASKKEEFSHDGTH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatctttaaaaaatagcaagagactagttatcaaggttggtacaagtacatta
atgtatggaaatggccatattaacctaagaactatcgaaaaattagcgatggttttatcc
gatttacgtaatgaaggaaaagaagttatcttagtttcttctggggcaatcggcgttgga
tgtcataaattacaacttccagtgcgacctacaagtattcccgaacaacaagcagttgct
tctgtcggtcagagtgaattaatgcatatatatagtaagttttttggtgaatacggacaa
gttgttggtcaagtactacttactcgagatgtaactgacttccctattagtagagaaaat
gttatgaacacgctcgaaagtctcttagaacgcggaattattcctatcgtaaatgaaaat
gatacagttgctgttgaggaactagaacatgtaactaaatacggcgataacgaccttctt
tcagctattgtagctaaactcgtgcaagctgatttacttatcatgctatctgatattgat
ggcttttatggtagtaatccttcaactgacccagatgcagttatgttttctgaaatcaat
caaataacaccagaaattgaagcacttgctggcggtaaaggttctaaattcggaactggt
ggcatgttaacgaaactttccgctgcttcttattgtatgaatgctaaccaaaaaatgatt
ttaaccaatggcaaaaatcctacaattatttttgatataatgcaaggtgaacaaatcggg
actttatttgcaagtaaaaaggaggaattttcccatgacggaactcattaa

DBGET integrated database retrieval system