KEGG   Listeria monocytogenes J0161: LMOG_00666Help
Entry
LMOG_00666        CDS       T01987                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00010  Glycolysis / Gluconeogenesis
lmj00020  Citrate cycle (TCA cycle)
lmj00620  Pyruvate metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01130  Biosynthesis of antibiotics
lmj01200  Carbon metabolism
Module
lmj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_00666
   00020 Citrate cycle (TCA cycle)
    LMOG_00666
   00620 Pyruvate metabolism
    LMOG_00666
Enzymes [BR:lmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMOG_00666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 NQRA RnfC_N GCV_H HlyD_D23 DUF896
Motif
Other DBs
NCBI-ProteinID: AEO03148
Position
1102203..1103837
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEDAALANNDATSAPATGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTTAQTEEKAAAPKAEKA
AAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataaaattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagttgctacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtgcaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgttaaagatattttagttagcgaaggaacagtagcaacagttggt
caagtattagtaacatttgaaggtgattttgaaggagaagcaagccatgaatctactcca
gaatctccagcagaagacgctgcacttgctaacaacgatgcaacttccgcaccagcaaca
ggtggaaacggaactccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgcgcgtgaaaaaggcgttaatatcgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggcgaacaaccagct
gcagcaacaactactgctcaaacagaagaaaaagcagctgcaccaaaagcagaaaaagca
gcagcaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcaattgcaaaagcaatggtaaactcaaaacatacagctccacacgtt
actttaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaacttactttcttaccttacatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatatgta
ccagtaattaaaaatgctgacaaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagtaattaattaccca
gaagttgctattctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtactagctctttccttgagctttgaccaccgtgtaattgacgga
gcaactgctcaaaaagcaatgaacaatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system