KEGG   Listeria monocytogenes J0161: LMOG_00687Help
Entry
LMOG_00687        CDS       T01987                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LMOG_00687
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LMOG_00687
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOG_00687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084080..1085543
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKEGKLVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIA
DILTKHDLITADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKEICETLKEAGYE
KRIKQLTGLKIDSYFSASKMMWLLENISAVRDAASRNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDTFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGAPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPVEELSAIGAIEIADNNLQNKRTIAKLYQPNITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatagccattgatcaaagcacatctggtacgaaagtattattg
tttaaagaaggcaaacttgtagatcgtttagataaaaagcatcgacagttgtatccaaag
aaaggctgggtggaacataatcccatcgaaatttgtcaaaatgtccgtacattaattgcg
gacatcttgacaaaacatgatttaattacagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacggggaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaaatttgcgaaacgttaaaagaagctggttatgaa
aaaagaattaaacagcttaccggactgaaaattgattcttatttttctgcttctaaaatg
atgtggttattggaaaatatttcagcggtgcgggatgcagcaagtcgtaatcaattggca
tttggcacaatggacgcttggttgttattttcacttacggatgatagtaattatttcaca
gaccgaacaaatgctagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaacttttcggagtcaaacgtgcttatttaccagaagtgaaacaatctgct
ggaagttttggaagttatcaggagataccaattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatacatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaagggattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggcgccccttattggaatacagatatacgagcagagattcttggcctcacg
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgataggtcaaaatattaagcgcttacaagta
gacggtgggttaacaaagcaacatgaattgatgcaatatttagctgatgttttaaaagca
gaagtggcagtcagtcccgtggaagaactttcggcaattggtgctattgaaattgccgac
aataacctacaaaataagagaacgatagcaaaattgtaccaaccaaatatcactcataca
catgctctggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system