KEGG   Listeria monocytogenes J0161: LMOG_00743Help
Entry
LMOG_00743        CDS       T01987                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LMOG_00743
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LMOG_00743
Enzymes [BR:lmj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LMOG_00743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1035558..1036037
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVERFPSKMKPEDFEDKVEALVAKVNN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaacggcaaagaaatagctttaagtgat
tataaaggtaaagttttactcatagtgaataccgcgagtaaatgtggcttaacacctcaa
ttagaaggtcttgaagcaatgtataaaaaattgggtggagataattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagaccctggtagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgactttccaaatgttttccaaaattaaagtaaaaggcaaa
gatgccagcccactttataaatatttaaccgaacaaactggtggcaaaaaagtagaatgg
aactttgcgaaattcttaattgatgaaaatggagaagttgttgaacgtttcccatctaaa
atgaaacctgaagattttgaggataaagtggaagcacttgttgcgaaagtaaataattaa

DBGET integrated database retrieval system