KEGG   Listeria monocytogenes J0161: LMOG_01131Help
Entry
LMOG_01131        CDS       T01987                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lmj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2170910..2171560)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNSEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPNIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLAFAPATSPELAEIVRKHVIELGDKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcgaaaatagtgaagacaatgtttgaccgt
tttgaaacgaatgcagctggaggaaatgtaagtgtgcgcatgaatagtgagcacattatt
atgacacctacacttatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtagtggaaggcgatgggagagttactagagaaattaac
ttacaccgtgcttgttacgtagaaaatccaaatatcggctgtgttcttcatgctcatccg
aaagaatcgatgttatttgcaacacttggtatggagttaccgaatttaacagaagcaacg
caaaaaatcggtcaaattccaacccttgcttttgcaccagcgactagtcccgaacttgcg
gaaatcgttcgtaaacacgttatcgagctaggggataaagccgttccaagtgcaagctta
ttaaataaacatggtattgtcgtattagatacatcacttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctacattgctgaaaaagcgttagtattcgatgctttaggt
ataaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

DBGET integrated database retrieval system