KEGG   Listeria monocytogenes J0161: LMOG_01190Help
Entry
LMOG_01190        CDS       T01987                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmj00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lmj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2116908..2118383)
Genome map
AA seq 491 aa AA seqDB search
MKLNELMQAIPVFTGEVSETIEISHIAQDSRKVKPGTLFICIDGEVVDGHQFASRAVELG
AVAIIAEKQVDVSIPVIYVRDSKRAMAMLADYFYGSPTQALKLVGITGTNGKTTVSHLVE
QIVRENGEQTGLIGTMYRKIGDQILETKNTTPDSLTLQETFRDMLLSGVSTAVMEVSSHA
LVQGRVYGSDYDVAVFMNLSQDHLDYHHTMEEYANAKSLLFAQLGNSYHTSNPKIAVLNA
DDAESVRMQKATAAHIITFGIKQEADFQASNIKITSHGSTFDLGTPVGNFTLKIKMIGNF
SVYNVLAAIATSFALHIPMEKAIKTVESIPGVKGRFELVHAGQEFPVIVDYAHTPDGLLN
VLETIDEFAEKRVFVVVGCGGDRDKGKRPQMAKIAVDYATNPIFTSDNPRSENPRAIIED
MIQGVPESDAYVVHENRRDAIRFAVNQAEAGDVILIAGKGHEDYQVVGDEVIDFDDRVEA
RIAIEKKLGLA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaatgaactaatgcaagctatcccggtttttactggcgaggtaagtgaaaca
attgaaattagccatatcgcccaagatagtagaaaagtaaaaccagggacattgtttatt
tgtatagacggagaagtagtggatggacaccagtttgcgtctcgtgcagtagaactagga
gcagtagcaattattgcagaaaaacaagtggatgtatcaattcctgtcatatatgtaaga
gattcaaaacgtgccatggcgatgttagccgattacttttatggatctccaacccaagcg
ttaaaactcgttgggattactgggacgaatggtaagacgaccgtgagccacttagtggaa
caaatcgttcgcgaaaatggtgagcaaacaggtttgattggcacgatgtatcgtaaaatt
ggcgaccaaattttagaaacaaaaaatacaacgccagacagcctaactttacaagaaaca
ttccgggacatgttactcagcggagtaagcacagctgtgatggaagtctcctcgcatgca
ctcgttcaaggtcgcgtatacggttcagactatgatgtcgctgtgtttatgaatttgtct
caagatcatttggattatcaccatacaatggaagaatatgccaatgcaaaaagcttattg
tttgcccaactaggcaacagctaccatacaagtaatccaaaaattgctgtattaaacgcg
gatgacgcggaaagtgtgcgtatgcaaaaagcaacagccgctcacattatcacttttggg
ataaaacaagaagctgacttccaagcaagtaatatcaaaattactagccatggttccaca
tttgatttagggacaccagttggtaatttcacattaaaaataaaaatgattgggaacttt
agtgtttataacgtattggctgcgattgcaacaagttttgcgctacatatccctatggaa
aaagcaattaaaacagtggaaagcataccgggtgtcaaaggacgttttgaacttgtacat
gcaggacaagagtttcctgttatagttgattacgctcatactccagacggcttgctaaat
gtattagaaacaattgatgaatttgcagaaaaacgcgtttttgtcgttgttggttgtggc
ggggatcgtgataaaggaaaacgtccacaaatggcgaaaatcgctgtagattatgcaaca
aatcctatttttacatcagataatccgcgtagtgaaaatccacgtgcgattattgaagat
atgattcaaggtgttccagaaagtgatgcttacgttgttcatgaaaaccgccgagatgcg
attcgttttgcagtaaatcaagcagaagcaggggatgttattctgattgctggaaaaggt
catgaagattatcaagtggttggtgacgaggttattgatttcgatgatcgcgtagaagct
cgaatagctattgaaaaaaaactcggactcgcataa

DBGET integrated database retrieval system