KEGG   Listeria monocytogenes J0161: LMOG_01413Help
Entry
LMOG_01413        CDS       T01987                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMOG_01413
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMOG_01413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1901163..1901783)
Genome map
AA seq 206 aa AA seqDB search
MMTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSR
EVFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGI
FIFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVSNAVQKI
KGIVETEHLKTERVIHRYKKMLEGLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaaagga
actgttcgggaagctgtttttaaagatccggaaacaagttttgattattctatttctatg
acaacgcgtcttccgcgtgaaggcgaacaagacggggtcgattattattttcgttcaaga
gaagtttttgaacaagctatcaaagacggaaaaatgttagaatatgcagagtacgtcggt
aactattacggcactccgcttgaatatgtcgaggaaaaacttgccgcaggagtggatatt
tttctcgaaattgaagtgcaaggagcaatgcaagttcgaaaagcgatgccagaaggaatt
ttcattttcttaacgccaccagatttatccgaactgaaaaaccggattatcggtcgcggt
acagagtcgatggaagttgttgaggaacgcatggaaacagcgaaaaaagaaatcgaaatg
atggcgtcttatgattatgctgtggtgaatgatgtcgtatcaaacgccgtacaaaaaatc
aaaggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaa
atgttggagggattacaatga

DBGET integrated database retrieval system