KEGG   Listeria monocytogenes J0161: LMOG_01649Help
Entry
LMOG_01649        CDS       T01987                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMOG_01649
Enzymes [BR:lmj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMOG_01649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2983326..2985026)
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
QKTLTTFKKMYDSYLKSAFEIVHFLPFYPYSSDDGFSVIDYKAVNPELGDWEDIKEMEQS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQFD
SGKVGHIWTTFSEDQIDLNFASPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAEFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRMSRFLVAHAVLMSIPGVPAVY
VQSILGSRNDYSGVETTGHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNLSEKEVSYSLDSGVYTNLYKGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatagtttg
gcagctagaatcgaagcacgggtacagcaaacgcaacaacgaaagttaacgcgaaaagat
cagtgggacgagaaagatattgttttaattacatatggggaccaatttaaagaggaatcc
caaaaaacgttaacaacttttaaaaaaatgtatgatagttatttaaaatcggcttttgag
atagttcatttcttgcctttttatccttattcttcggatgatgggttttcggtcatcgat
tataaagcggtgaacccggaacttggtgattgggaagatattaaggagatggaacagtcg
gcgcggttgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgatatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaagacg
gaccttagttcggtaacaaggccacgtgcgacaccagtgctgacaccatttcaatttgat
tcaggaaaagtagggcatatttggacgacttttagtgaggatcaaatcgatttaaacttt
gcttctccggaagtgctttacaagatgattgatgttttgatgttctatttagaagaaggt
gcggaatatgtgcgacttgatgcggttggctttatgtggaaagtgccgggaacgagttcg
attcacttagaagagacgcatgaaatcgtgaaattatttagagatttagtagacattgca
gctccggggacgattattattaccgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgctatccatcatggtaatgcagaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcggacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcggcattattccagaagctgaaattttggctttagtgaatgatttggag
gaagaaggcgcgctcgtttcatataagcaaaatccagatggttctaagagtccgtatgaa
atcaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgacttgaggatg
tcgagatttcttgtggctcatgcagtactaatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattattcaggcgtagaaacaacaggccacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgctaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgcagaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttataagggctccacagta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

DBGET integrated database retrieval system