KEGG   Listeria monocytogenes J0161: LMOG_01732Help
Entry
LMOG_01732        CDS       T01987                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2901935..2903389
Genome map
AA seq 484 aa AA seqDB search
MEHNKLKPFPKDFLWGSASAAYQVEGAWDEDGKGPSVWDEFVRIPGTTFKETNGDVAVDN
YHRYKEDVALMAEQGLKAYRFSVAWSRVIPHGNGEVNEAGLKFYDNLIDELLSYGIEPVV
TLYHWDIPQGLQDEYGGWESRKVVEDFTNYAALLFERFNGRVKYWVTLNEQNVFISHGYK
LAYHPPGVSNDKRMFAANHNANLANASAIAKFRELGTSGKIGPSFAYGPSYSIDANPANV
LASENSEEFNAHFWMDVYTWGEYPTATWNWLEEHGLAPEILPGDTELLKKGKPDFMGVNY
YRSMTHAFNGKDGVGSGKMNTTGEKGTSEETGVPGLYKNTNNPYLEKTNWDWDIDPTGLR
IGLRRITNRYKLPIMITENGLGEYDSLTEDHKIHDEYRIEYIRAHALAIQEAITDGVEML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDENDEKELKRYKKDSFYWYKKTIEANGANLVE
EQGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacataataagttgaaacctttcccaaaagattttctatggggatcagcttctgca
gcgtaccaagtagaaggtgcctgggatgaggatggcaaaggaccatctgtatgggatgaa
tttgttcgcattcctggaacaacattcaaagaaacaaacggagatgtagcggtggacaat
taccatcgttataaagaagatgtcgcattgatggctgaacagggcctaaaagcatatcgt
ttctctgtcgcatggagtcgcgttatcccgcatggtaacggggaggttaacgaagctgga
ctgaaattctatgataatttgattgatgaacttctttcttatggaattgagcctgttgtt
acactttaccactgggatattccgcaagggcttcaagacgaatatggtggatgggagtcg
cgcaaagtcgtagaagatttcactaactacgctgcccttctattcgaacgctttaacggc
cgagttaaatactgggtaacacttaatgaacaaaacgtatttatctcacacggttacaaa
ttagcgtatcacccacctggcgtttctaacgacaagcgtatgtttgcggcaaatcacaat
gcgaacttggcgaatgcttctgcaattgctaaattccgcgagctaggtacatccggaaaa
attggaccaagttttgcttacggaccaagttactccattgatgccaacccagcgaacgtg
ttagcttctgaaaactccgaagaattcaacgcccatttctggatggatgtttacacatgg
ggtgaatatcctactgctacttggaactggctggaagagcacggtcttgcaccggaaatc
ttaccaggcgatacggaacttctgaaaaaaggaaaacctgatttcatgggagttaactat
taccgctcaatgactcatgcatttaatgggaaagacggcgttggttctgggaaaatgaac
acaactggcgaaaaaggcacttccgaggaaactggtgtaccggggttatacaaaaacacc
aataatccttacttagagaaaacgaattgggactgggatattgatccaactggcttgcgc
attggcttacgtagaattactaaccgctataaattaccaatcatgattacagaaaacggt
cttggtgagtatgatagcttgacggaagaccataaaatccatgatgagtaccggattgaa
tacattcgcgcgcatgctctagcaatccaagaagcaatcacggacggtgtagagatgctt
ggttactgcacttggagcttcacagatttactaagctggttaaacggctaccaaaaacgt
tacggtttcgtatatgttgaccgcgatgaaaatgatgaaaaagaattaaaacgctataaa
aaagacagtttttactggtataaaaagacaatcgaagcaaacggagctaatttagtagaa
gaacagggcaaataa

DBGET integrated database retrieval system