KEGG   Listeria monocytogenes J0161: LMOG_01797Help
Entry
LMOG_01797        CDS       T01987                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lmj  Listeria monocytogenes J0161
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2836854..2837450)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatagatagttttatgaaattaccaggaatt
ggaccaaaatcggcagctcggctagcattttatgtgttagatatgaaagaagacgatgtg
ctagattttgcaaaagcacttgttgatgcgaagagaaacctaagcttttgttccgtttgt
ggtcacattacagataaggatccatgttatatttgtgctgatacgtcacgcgatcgaagt
gttatttgtgtggtacaagaatccaaagatgtcattgcaatggaaaaaatgcgtgatttt
catggcttataccacgtgcttcatggcacaatttctccaatggacggaattggaccagaa
gatattaatattcctgatttgctgaaacgtttgcaagatgacactattgaagaagttatt
ttagcaacaaatccaaatgttgaaggagaagccactgcgatgtatatttcgcgtttacta
aaaccttcaggcataaaagtaacgagaatagcacatggccttccagtgggtggagactta
gaatatgcggatgaagtgacgctttcaaaagcaatggaaggacgaagagaagtctaa

DBGET integrated database retrieval system