KEGG   Listeria monocytogenes J0161: LMOG_02312Help
Entry
LMOG_02312        CDS       T01987                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00260  Glycine, serine and threonine metabolism
lmj00750  Vitamin B6 metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01230  Biosynthesis of amino acids
Module
lmj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOG_02312
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOG_02312
Enzymes [BR:lmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOG_02312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: AEO04645
Position
complement(2631344..2632399)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWRLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
cttggggttactttatacggaaaatacgaaggcttaaatccaaccggttcttttaaagat
cgtggaatggttatggctgttgcaaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tatggcgcagatattatctcgattcaaggtaattttgatgaagcattaaaatcggttcgt
gaattagctgaaacagaagcagtaacacttgtaaattccgtgaatccatatcgtttagaa
ggtcaaaaaacagctgcattcgaaatctgtgagcaattaggttccgcgccagatgtactt
gcaattccagtcggtaatgccgggaatatttctgcatactggaaggggtttaaagaatgg
aatgaggctaaagcttctggactgccgcggatgcatggttttgaagcagaaggagctgcg
gcgattgttcaagggaaaccaattgataacccggaaacaattgcaacagcgattcgtatc
ggaaacccagctagttggcggcttgcagaagcagctcgcgatgaatctggcggatacatc
cattctgtaacagacgacgaaattgtgaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccgggttctgccgcttcattagctggtgtcattcaacatgtagcaaat
ggaacaattaaaaaaggggaaacagttgtttgtgtctttactggaaatggcttaaaagat
ccagatactgcgatgagtgtgcatgaaattccaatttcccatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system