KEGG   Listeria monocytogenes J0161: LMOG_02312Help
Entry
LMOG_02312        CDS       T01987                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOG_02312
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOG_02312
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOG_02312
Enzymes [BR:lmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOG_02312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2631344..2632399)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWRLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
cttggggttactttatacggaaaatacgaaggcttaaatccaaccggttcttttaaagat
cgtggaatggttatggctgttgcaaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tatggcgcagatattatctcgattcaaggtaattttgatgaagcattaaaatcggttcgt
gaattagctgaaacagaagcagtaacacttgtaaattccgtgaatccatatcgtttagaa
ggtcaaaaaacagctgcattcgaaatctgtgagcaattaggttccgcgccagatgtactt
gcaattccagtcggtaatgccgggaatatttctgcatactggaaggggtttaaagaatgg
aatgaggctaaagcttctggactgccgcggatgcatggttttgaagcagaaggagctgcg
gcgattgttcaagggaaaccaattgataacccggaaacaattgcaacagcgattcgtatc
ggaaacccagctagttggcggcttgcagaagcagctcgcgatgaatctggcggatacatc
cattctgtaacagacgacgaaattgtgaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccgggttctgccgcttcattagctggtgtcattcaacatgtagcaaat
ggaacaattaaaaaaggggaaacagttgtttgtgtctttactggaaatggcttaaaagat
ccagatactgcgatgagtgtgcatgaaattccaatttcccatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system