KEGG   Listeria monocytogenes J0161: LMOG_02407Help
Entry
LMOG_02407        CDS       T01987                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOG_02407
   01230 Biosynthesis of amino acids
    LMOG_02407
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02407
   00051 Fructose and mannose metabolism
    LMOG_02407
   00562 Inositol phosphate metabolism
    LMOG_02407
Enzymes [BR:lmj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOG_02407
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOG_02407
  Exosomal proteins of bladder cancer cells
   LMOG_02407
  Exosomal proteins of melanoma cells
   LMOG_02407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2538461..2539228)
Genome map
AA seq 255 aa AA seqDB search
MFIQMRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEG
TNLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAI
FKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGK
SSTSADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGA
SLEPASFLALLEAVK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtttatccaaatgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgct
gcaaaagcaggacaatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgtt
gaatcagtagttgctgcaccggctctatttttacaagaattagttcgtcttactgaagga
actaatcttcgtgtatctgcacaaaactgttattttgaagacgaaggtgctttcactggc
gaaattagcccgtttgcacttgctgacttaggcgtttcttatgttattatcggacactct
gaacgtcgtgagtacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatc
ttcaaacacggcatgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagct
ggtcaaacagatacttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaa
gaacaagtaatcaaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaa
tcttctacaagtgctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgac
gctgtatctcaaaaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacct
gaaaacattgctgattatcttgcagagtccgacattgacggcgctcttgtaggtggggca
agcttagaaccagcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system