KEGG   Listeria monocytogenes J0161: LMOG_02415Help
Entry
LMOG_02415        CDS       T01987                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lmj  Listeria monocytogenes J0161
Brite
Enzymes [BR:lmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LMOG_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2532003..2532749)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTTEQIDAEMVAYKDAPMNTIAKLKDEISGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacaattacacttgctacgcccctcaatacagaggccacggtgtatctcccgacctactg
ctaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggctatactgaaatcgctgtggcgggactttcgctcggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagctcatccccgataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacaactgaacaaattgatgctgaaatggttgcctataaagacgccccaatg
aataccatcgctaaattaaaagacgagataagtggcgtcgtggctgaaatagatatgatc
tatgcaccaattatggtcgtccaaggtgaaaaagatgatatggttgatgtcagcggagca
cagctgatttatgatacagtagagtcaacgaagaaagaacttcactggtttaaggaatct
ggtcatgtcatcacattagacaaagaacgaaaagaagtaaaccaagccattttaacattt
ttagatagtttggattggcaagaataa

DBGET integrated database retrieval system