KEGG   Listeria monocytogenes J0161: LMOG_02495Help
Entry
LMOG_02495        CDS       T01987                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOG_02495
   01230 Biosynthesis of amino acids
    LMOG_02495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02495
  Energy metabolism
   00680 Methane metabolism
    LMOG_02495
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOG_02495
Enzymes [BR:lmj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LMOG_02495
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LMOG_02495
  Exosomal proteins of melanoma cells
   LMOG_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360742..361356
Genome map
AA seq 204 aa AA seqDB search
MTKIYLIRHGESQANYDNKNNHAYFSGQLDSPLTAKGINSAKKLRDYFNNIEMNIIYSSD
SIRARETCKHGFSSDTPLIISKLLRERSLGDFEGKRIEDVKKDKRYIKFFNDSNFTEFRH
SFHQKAPFGENYLDVYKRIQIFFNQIFLNENHSSVIIAHQTTIRCCLLYLREISKEEVFN
LRIPNCEPIVVDIKKGVIYERCIE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatctatcttataagacatggagaatcacaagctaattatgataacaaaaat
aatcatgcttacttttctggacaattagatagtcctttaacagctaaaggtattaactca
gcaaaaaaattaagagattatttcaataatattgaaatgaacattatatattcatctgat
agtattagggcaagggagacttgtaaacatggatttagttctgatacaccattaataatt
tcaaaattgttaagagaacggtcattaggggattttgaaggtaaaagaatcgaggatgtg
aaaaaagataaacgatatattaaattttttaacgattctaactttactgagtttaggcac
agttttcatcaaaaagcgccgtttggagaaaattatttagatgtatataaacgaatacaa
attttttttaatcagatttttttgaatgaaaatcattcttctgttattattgcccaccaa
accacaataagatgttgcttactttacttaagagaaatttccaaagaagaggtttttaat
ttacgcattcctaactgtgaaccaatagtagttgacataaagaaaggggtaatttatgag
agatgtattgaatga

DBGET integrated database retrieval system