KEGG   Listeria monocytogenes J0161: LMOG_02495Help
Entry
LMOG_02495        CDS       T01987                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00010  Glycolysis / Gluconeogenesis
lmj00260  Glycine, serine and threonine metabolism
lmj00680  Methane metabolism
lmj01100  Metabolic pathways
lmj01110  Biosynthesis of secondary metabolites
lmj01120  Microbial metabolism in diverse environments
lmj01130  Biosynthesis of antibiotics
lmj01200  Carbon metabolism
lmj01230  Biosynthesis of amino acids
Module
lmj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02495
  Energy metabolism
   00680 Methane metabolism
    LMOG_02495
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOG_02495
Enzymes [BR:lmj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LMOG_02495
Membrane trafficking [BR:lmj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LMOG_02495
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LMOG_02495
  Exosomal proteins of melanoma cells
   LMOG_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEO02406
Position
360742..361356
Genome map
AA seq 204 aa AA seqDB search
MTKIYLIRHGESQANYDNKNNHAYFSGQLDSPLTAKGINSAKKLRDYFNNIEMNIIYSSD
SIRARETCKHGFSSDTPLIISKLLRERSLGDFEGKRIEDVKKDKRYIKFFNDSNFTEFRH
SFHQKAPFGENYLDVYKRIQIFFNQIFLNENHSSVIIAHQTTIRCCLLYLREISKEEVFN
LRIPNCEPIVVDIKKGVIYERCIE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatctatcttataagacatggagaatcacaagctaattatgataacaaaaat
aatcatgcttacttttctggacaattagatagtcctttaacagctaaaggtattaactca
gcaaaaaaattaagagattatttcaataatattgaaatgaacattatatattcatctgat
agtattagggcaagggagacttgtaaacatggatttagttctgatacaccattaataatt
tcaaaattgttaagagaacggtcattaggggattttgaaggtaaaagaatcgaggatgtg
aaaaaagataaacgatatattaaattttttaacgattctaactttactgagtttaggcac
agttttcatcaaaaagcgccgtttggagaaaattatttagatgtatataaacgaatacaa
attttttttaatcagatttttttgaatgaaaatcattcttctgttattattgcccaccaa
accacaataagatgttgcttactttacttaagagaaatttccaaagaagaggtttttaat
ttacgcattcctaactgtgaaccaatagtagttgacataaagaaaggggtaatttatgag
agatgtattgaatga

DBGET integrated database retrieval system