KEGG   Listeria monocytogenes J0161: LMOG_02495Help
Entry
LMOG_02495        CDS       T01987                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOG_02495
   01230 Biosynthesis of amino acids
    LMOG_02495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02495
  Energy metabolism
   00680 Methane metabolism
    LMOG_02495
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOG_02495
Enzymes [BR:lmj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LMOG_02495
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LMOG_02495
  Exosomal proteins of melanoma cells
   LMOG_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
360742..361356
Genome map
AA seq 204 aa AA seqDB search
MTKIYLIRHGESQANYDNKNNHAYFSGQLDSPLTAKGINSAKKLRDYFNNIEMNIIYSSD
SIRARETCKHGFSSDTPLIISKLLRERSLGDFEGKRIEDVKKDKRYIKFFNDSNFTEFRH
SFHQKAPFGENYLDVYKRIQIFFNQIFLNENHSSVIIAHQTTIRCCLLYLREISKEEVFN
LRIPNCEPIVVDIKKGVIYERCIE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatctatcttataagacatggagaatcacaagctaattatgataacaaaaat
aatcatgcttacttttctggacaattagatagtcctttaacagctaaaggtattaactca
gcaaaaaaattaagagattatttcaataatattgaaatgaacattatatattcatctgat
agtattagggcaagggagacttgtaaacatggatttagttctgatacaccattaataatt
tcaaaattgttaagagaacggtcattaggggattttgaaggtaaaagaatcgaggatgtg
aaaaaagataaacgatatattaaattttttaacgattctaactttactgagtttaggcac
agttttcatcaaaaagcgccgtttggagaaaattatttagatgtatataaacgaatacaa
attttttttaatcagatttttttgaatgaaaatcattcttctgttattattgcccaccaa
accacaataagatgttgcttactttacttaagagaaatttccaaagaagaggtttttaat
ttacgcattcctaactgtgaaccaatagtagttgacataaagaaaggggtaatttatgag
agatgtattgaatga

DBGET integrated database retrieval system