KEGG   Listeria monocytogenes J0161: LMOG_02512Help
Entry
LMOG_02512        CDS       T01987                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02512
Enzymes [BR:lmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOG_02512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342608..344023)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SHPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEQDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccgactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcacattactgacggtccaacaccagataacttaaaattagaagga
atcgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcaggacttcaattttacgatgatttattcgatgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgtaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactcgattttacac
gcaccattcatgagtggcggtatttctacaagcccagataaattatcacaaaaagaccta
taccaagctgtccaccacgaacttgtggcgagcgcacttgcaacaaaaatcggtcacgaa
atcatgccagaagctcaaatcggctgcatggttctagcaatgccaacctatccgctaact
tcccatcccgatgacattatcgctgttatggaagctgagcgcaaaaactatttcttctcc
gacgttcatgttcgcggaacttatccgggctatatgaaacgctatttcagagaaaacaat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tctttcagctattacatgagcacaactgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggcggcgtgcaaaacccttacctagaagcatccgaatggggttgg
caaatcgatcctcaaggcttgcgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaacaagacgaaaac
ggcaactatacagtaaatgacgactatcgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gaccttgtaagtgcctccactgctgaaatgaagaaacgttacggctttatctatgttgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aaaaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system