KEGG   Listeria monocytogenes J0161: LMOG_02564Help
Entry
LMOG_02564        CDS       T01987                                 

Definition
(GenBank) peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmj  Listeria monocytogenes J0161
Pathway
lmj00300  Lysine biosynthesis
lmj01100  Metabolic pathways
lmj01120  Microbial metabolism in diverse environments
lmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LMOG_02564
Enzymes [BR:lmj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LMOG_02564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42 Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: AEO02341
Position
293687..294826
Genome map
AA seq 379 aa AA seqDB search
MDQQKKIQILKDLVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
NEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLILFYNEIEKYVASIHATNEILGDFIHNVTVINGGNQV
NSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHVKLELLFDYDKQPVFSDRNS
SLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKQFPVIIFGPGNETPHQVNENVSI
GNYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaaaaaaagattcaaattttaaaggacttggtaaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtacaatacgacgtagacagagctagcctagtaagcgaaattggttccagt
aacgagaaggttttggcattttcagggcatatggatgtagttgatgcgggtgatgtatct
aagtggaagttcccaccttttgaagcgacagagcatgaagggaaactatacggacgcggc
gcaacggatatgaagtcaggtctagcggcgatggttattgcaatgattgaacttcatgaa
gaaaaacaaaaactaaacggcaagatcagattattagcaacagttggggaagaaatcggt
gaacttggagcagaacaactaacacaaaaaggttacgcagatgatttagatggtttaatc
atcggcgaaccgagtggacacagaatcgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccggaatttggtgtgaatgcaatt
gataatttgatactattttataatgaaatagaaaaatacgttgcttccatccatgccaca
aatgaaatacttggcgattttattcataatgtcacggtgattaatggcggaaatcaagtc
aatagtattccggaaaaagcagaactacaaggtaatattcgttccataccagaagttgat
aacgagactttgaagcgacgtattgttgaaattgtgaatgagttaaataaaaaagaacat
gtgaagttagagttactgttcgattatgataaacagcctgtatttagcgataggaattca
agcttagtgaatgtcgcacgtgatgttgcgaaaggtattattaaagaagagataccctta
cttggaatttctggaacaacagatgcagctgaatttaccaaagcgaagaaacaattccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
ggaaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system