KEGG   Listeria monocytogenes J0161: LMOG_02564Help
Entry
LMOG_02564        CDS       T01987                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmj01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmj00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
293687..294826
Genome map
AA seq 379 aa AA seqDB search
MDQQKKIQILKDLVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
NEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLILFYNEIEKYVASIHATNEILGDFIHNVTVINGGNQV
NSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHVKLELLFDYDKQPVFSDRNS
SLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKQFPVIIFGPGNETPHQVNENVSI
GNYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaaaaaaagattcaaattttaaaggacttggtaaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtacaatacgacgtagacagagctagcctagtaagcgaaattggttccagt
aacgagaaggttttggcattttcagggcatatggatgtagttgatgcgggtgatgtatct
aagtggaagttcccaccttttgaagcgacagagcatgaagggaaactatacggacgcggc
gcaacggatatgaagtcaggtctagcggcgatggttattgcaatgattgaacttcatgaa
gaaaaacaaaaactaaacggcaagatcagattattagcaacagttggggaagaaatcggt
gaacttggagcagaacaactaacacaaaaaggttacgcagatgatttagatggtttaatc
atcggcgaaccgagtggacacagaatcgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccggaatttggtgtgaatgcaatt
gataatttgatactattttataatgaaatagaaaaatacgttgcttccatccatgccaca
aatgaaatacttggcgattttattcataatgtcacggtgattaatggcggaaatcaagtc
aatagtattccggaaaaagcagaactacaaggtaatattcgttccataccagaagttgat
aacgagactttgaagcgacgtattgttgaaattgtgaatgagttaaataaaaaagaacat
gtgaagttagagttactgttcgattatgataaacagcctgtatttagcgataggaattca
agcttagtgaatgtcgcacgtgatgttgcgaaaggtattattaaagaagagataccctta
cttggaatttctggaacaacagatgcagctgaatttaccaaagcgaagaaacaattccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
ggaaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system