KEGG   Listeria monocytogenes J0161: LMOG_02738Help
Entry
LMOG_02738        CDS       T01987                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOG_02738
   01230 Biosynthesis of amino acids
    LMOG_02738
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOG_02738
   00051 Fructose and mannose metabolism
    LMOG_02738
   00562 Inositol phosphate metabolism
    LMOG_02738
Enzymes [BR:lmj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOG_02738
Exosome [BR:lmj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOG_02738
  Exosomal proteins of bladder cancer cells
   LMOG_02738
  Exosomal proteins of melanoma cells
   LMOG_02738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(399669..400433)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLSGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLSANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggaacactcgaaacgactgccaaccttttatcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatcaatcattgatctaagcgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatcaaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaagcaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acaaactacatcgaaagcgctcatcaagctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system