KEGG   Listeria monocytogenes J0161: LMOG_03066Help
Entry
LMOG_03066        CDS       T01987                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOG_03066
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LMOG_03066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197537..198418
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggatggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcgcactttatt
ccagaagatcgtcgcaatttaatttatcaagcggccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcatattcctgtttctgcgggacttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcagaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactggacgcggggagaaaatttctgcgttacctaat
attcctggttgttggattgtacttgctaagccgagcattagcgtgtcaacacccactatc
tataaagaacttcaagtagacaatgtagaacacccagacacacaaaaaatgattgaatcc
atcaaaaatggtgatttagacgggatttttgcggctacagggaatgtgctagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaattattaa

DBGET integrated database retrieval system