KEGG   Listeria monocytogenes J0161: LMOG_03272Help
Entry
LMOG_03272        CDS       T01987                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237406..237885
Genome map
AA seq 159 aa AA seqDB search
MAKAFLSIGTNIGERLENLNDALSGLAASDKINITNVSSVYETDAVGYEDQAAFLNIAVE
IETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKE
RAFVMIPLIEISPEKSNLVENPALLEEQGVRKIKNQVNW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcatttctgtcaattggtacaaacattggcgaacgtttagaaaatttaaat
gacgcactaagtggtttagctgcctcagataaaattaatatcaccaacgtatctagcgta
tacgaaacagatgcagtaggttacgaagatcaagcagcatttttaaatatcgctgtagaa
attgaaacggactttccgccaattgatttattagatttttgccttgcgctcgaacttgaa
ttggggcgagttcgattatttaagtggggtccgcgactcattgatattgatgttttatta
tatgatgatgttaaaaccgatacagaaaagctaaaaatcccacatccttatatgaaagaa
cgtgcttttgtgatgattccattaatagaaatttcaccagaaaaaagcaatcttgtagag
aatccggcccttttggaagaacaaggtgttcggaaaataaaaaatcaagtcaactggtaa

DBGET integrated database retrieval system