KEGG   Listeria monocytogenes J0161: LMOG_03303Help
Entry
LMOG_03303        CDS       T01987                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmj  Listeria monocytogenes J0161
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOG_03303
   00052 Galactose metabolism
    LMOG_03303
   00500 Starch and sucrose metabolism
    LMOG_03303
   00520 Amino sugar and nucleotide sugar metabolism
    LMOG_03303
Enzymes [BR:lmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMOG_03303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130747..1131619)
Genome map
AA seq 290 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQFIVEEAVASGIEDILIVTGKGK
RAIEDHFDSVPELENNLREKNKLDLLHLVEETTNINLHFIRQSKPKGLGDAILQAKGFIG
NEPFVVMLGDDIVQSKTPCAKQLIDQYEKTHSSVIGVQNVPREETYRYGIIDPDKEVSDR
LYNVTGFVEKPNVEDAPSNLAILGRYLLTPEIFKYLETQEAGSGGEIQLTDAINRLNEIQ
PVFAYDFEGERFDVGDKFGFIETTLKFALKHPEIKDDVRDLIIRLGDELK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaagcagtcatcccggcagcaggacttggtacaagatttcttcctgca
acaaaagcgatgccaaaagaaatacttccaattgtagacaaaccaacgattcaatttatc
gttgaagaagcagttgcgtctggaattgaagatattctaattgttacagggaaaggaaaa
agagccatagaagaccatttcgactctgtacctgaacttgaaaataatttacgtgaaaaa
aacaaattagatttattacatttagtggaagaaaccactaatattaacttacattttatt
cgtcagtcgaaacctaagggacttggagacgcaattttacaagctaaaggtttcattggt
aacgaaccatttgtagtaatgcttggggatgacatcgttcaatctaaaaccccttgtgct
aaacaattaatcgatcaatacgaaaagactcatagttctgttatcggtgtacaaaatgtt
cctcgcgaagaaacatatcgttacggcattattgatcctgacaaagaagtaagtgatcgt
ttgtataatgtaactggttttgtggaaaagcctaatgtagaagatgctccttccaactta
gcgattttaggaagatatttattaactccagaaatttttaagtatctagaaacacaagaa
gctggttctggtggagaaattcaattaactgatgcaattaaccgtttaaatgaaattcaa
cctgttttcgcctatgattttgaaggagaacgttttgatgttggtgataaattcggcttt
attgaaactactttaaaatttgcgctaaaacatcccgaaattaaagacgatgtccgcgac
ctaattatccgtctcggcgatgaacttaaataa

DBGET integrated database retrieval system