KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_0484Help
Entry
LMES_0484         CDS       T02997                                 

Definition
4-aminobutyrate aminotransferase related aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
Pathway
Alanine, aspartate and glutamate metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LMES_0484
   00650 Butanoate metabolism
    LMES_0484
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMES_0484
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMES_0484
Enzymes [BR:lmk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LMES_0484
Amino acid related enzymes [BR:lmk01007]
 Aminotransferase (transaminase)
  Class III
   LMES_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
516432..517766
Genome map
AA seq 444 aa AA seqDB search
MSKNKEILEEEKIHLANATRVKYFDIVIDHGKGAIITDADGHDYIDLLASASATNTGHSH
PKVVEAITSQAQKLIQYTPAYFANTVTAKLADRLVNVAPGNFQKQVAFGNSGSDANDAII
KFARGYTGRQYVVSFTGAYHGSTYGSLSISGVSLNMTRKIGPLLPNTVKVPFPDQTQRIA
GESDNDFSERLFKQFKLPFETYLPADEVALVIIEPIQGDGGIIKAPQHYVELVYEFTREH
GIVFAVDEVNQGLGRTGKMWSIDHFGIAPDLMSVGKSIASGLPLSAVIGRKEIMDSLQAP
ANVYTTAGNPVTAAAALATLDVIEEENLVARSRQLGELAKAFFESAAKRYAFIGDVRLYG
LNGGIDIINDHGEADNEATNKLIYRIFELGAIMISLRGNTLRFQPPLVIREEELQRAFEI
LEKAFSDLASGKIALPKTDNHIGW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaataaagagattttagaagaagaaaaaattcacttggcaaatgcaacgcgg
gttaaatattttgatattgtcattgatcacggaaaaggagccatcattacggatgcagat
gggcatgactatattgacttattggctagtgcaagtgccactaatacaggtcattcacat
ccaaaggttgtggaagcaattactagccaagctcaaaaattaattcagtatacgcctgca
tattttgctaacacggtgactgcaaaattagctgatcgcttagtgaatgtagcaccaggg
aacttccaaaaacaagttgcttttggtaattcgggatcggatgcaaacgatgcgattatc
aagtttgcccgtggatatactgggcgacaatatgttgtcagttttacgggtgcttatcac
ggctctacatatggttcgctttctatctcaggagtcagcttgaatatgactcgaaaaatt
gggccactattgccaaacacggtgaaagtaccttttcctgatcagacgcaacgaatagcc
ggagaaagcgacaatgatttttccgaacgtttatttaaacagtttaaattaccatttgag
acttatttaccagcagatgaagtggcgttagttattattgaacctattcaaggtgatggt
ggaattatcaaagcaccacaacattatgttgaattggtttatgagtttacacgtgaacat
ggcattgtttttgctgtcgatgaggttaatcaaggccttggacgaactggtaaaatgtgg
tcaattgatcattttgggattgccccagatttaatgagtgttggtaaatcgattgccagt
ggattgcctttaagtgcagttattgggcgcaaagaaattatggacagtctgcaagcacca
gctaatgtttacacgaccgctggtaacccagtaacagcagcggcagcgctagcaacgcta
gacgttattgaagaggagaacttagttgcacgttctcgacaactgggtgagttggctaaa
gcattctttgagtctgctgctaaacgttatgcctttattggagacgtccgtttatatggt
ttgaatggtggtattgatattatcaatgatcatggtgaagctgataatgaggcaactaat
aagttaatttatcgtatttttgagttaggggcgattatgattagcctaagaggaaacacc
ttgcgttttcaacccccactagttattcgagaagaggagttgcagcgcgcctttgaaata
ttagaaaaagcattttctgatttagcgtcgggtaaaattgcattaccaaaaactgataat
cacattggttggtaa

DBGET integrated database retrieval system