KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_0484Help
Entry
LMES_0484         CDS       T02997                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase related aminotransferase
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
516432..517766
Genome map
AA seq 444 aa AA seqDB search
MSKNKEILEEEKIHLANATRVKYFDIVIDHGKGAIITDADGHDYIDLLASASATNTGHSH
PKVVEAITSQAQKLIQYTPAYFANTVTAKLADRLVNVAPGNFQKQVAFGNSGSDANDAII
KFARGYTGRQYVVSFTGAYHGSTYGSLSISGVSLNMTRKIGPLLPNTVKVPFPDQTQRIA
GESDNDFSERLFKQFKLPFETYLPADEVALVIIEPIQGDGGIIKAPQHYVELVYEFTREH
GIVFAVDEVNQGLGRTGKMWSIDHFGIAPDLMSVGKSIASGLPLSAVIGRKEIMDSLQAP
ANVYTTAGNPVTAAAALATLDVIEEENLVARSRQLGELAKAFFESAAKRYAFIGDVRLYG
LNGGIDIINDHGEADNEATNKLIYRIFELGAIMISLRGNTLRFQPPLVIREEELQRAFEI
LEKAFSDLASGKIALPKTDNHIGW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaataaagagattttagaagaagaaaaaattcacttggcaaatgcaacgcgg
gttaaatattttgatattgtcattgatcacggaaaaggagccatcattacggatgcagat
gggcatgactatattgacttattggctagtgcaagtgccactaatacaggtcattcacat
ccaaaggttgtggaagcaattactagccaagctcaaaaattaattcagtatacgcctgca
tattttgctaacacggtgactgcaaaattagctgatcgcttagtgaatgtagcaccaggg
aacttccaaaaacaagttgcttttggtaattcgggatcggatgcaaacgatgcgattatc
aagtttgcccgtggatatactgggcgacaatatgttgtcagttttacgggtgcttatcac
ggctctacatatggttcgctttctatctcaggagtcagcttgaatatgactcgaaaaatt
gggccactattgccaaacacggtgaaagtaccttttcctgatcagacgcaacgaatagcc
ggagaaagcgacaatgatttttccgaacgtttatttaaacagtttaaattaccatttgag
acttatttaccagcagatgaagtggcgttagttattattgaacctattcaaggtgatggt
ggaattatcaaagcaccacaacattatgttgaattggtttatgagtttacacgtgaacat
ggcattgtttttgctgtcgatgaggttaatcaaggccttggacgaactggtaaaatgtgg
tcaattgatcattttgggattgccccagatttaatgagtgttggtaaatcgattgccagt
ggattgcctttaagtgcagttattgggcgcaaagaaattatggacagtctgcaagcacca
gctaatgtttacacgaccgctggtaacccagtaacagcagcggcagcgctagcaacgcta
gacgttattgaagaggagaacttagttgcacgttctcgacaactgggtgagttggctaaa
gcattctttgagtctgctgctaaacgttatgcctttattggagacgtccgtttatatggt
ttgaatggtggtattgatattatcaatgatcatggtgaagctgataatgaggcaactaat
aagttaatttatcgtatttttgagttaggggcgattatgattagcctaagaggaaacacc
ttgcgttttcaacccccactagttattcgagaagaggagttgcagcgcgcctttgaaata
ttagaaaaagcattttctgatttagcgtcgggtaaaattgcattaccaaaaactgataat
cacattggttggtaa

DBGET integrated database retrieval system