KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_0617Help
Entry
LMES_0617         CDS       T02997                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lmk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMES_0617
Enzymes [BR:lmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LMES_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
657191..658141
Genome map
AA seq 316 aa AA seqDB search
MIIKEILSKLDGNMTKNIVVLGSLNVDNIMKMPRMPLVGETMALTEVTTAPGGKGANQAV
AASRQGANVSFIGAVGNDANGQFMRATLLTNGVNVDAVSTNSDVPTGSAYIMLQESGANT
ILIHGGANQALTIEDINKALIAQADVLIAQFEVPFEVILAAFKIAKKNNVQTILNPAPAV
YELTPELMAVTDIVLPNETEAQLLTGINVINDEGVLNRVSDALQAKGVQRSIITLGEAGS
FIADGQKRWWVQPEKVDAQDTTAAGDTFIGTLASVIAPDFSNLDDAVQRANIASAIAVTR
PGAIPSIPTDKEVDNY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgataataaaagaaattttatcaaaattggacgggaacatgactaaaaacattgtcgta
ctcggcagcttgaatgtcgataatattatgaaaatgccacgtatgccactggttggtgaa
acgatggcacttactgaagtaacaacagcaccaggtggtaaaggggctaatcaggcagtt
gccgcatcacgacaaggagcaaatgtttcatttatcggtgctgttgggaatgatgcaaat
ggacagtttatgagagcaacattactcaccaatggtgtcaatgtggacgcagtgtcaaca
aatagtgatgtgccaactggatcagcatacattatgttgcaagagagtggtgcaaacaca
atattgattcatggtggggcaaaccaagccttaacgattgaggacataaataaagcgtta
attgcgcaagctgatgtgctaatcgcacaatttgaagtgccgttcgaagttattttggcg
gcatttaaaattgctaaaaaaaataatgtgcaaacaatcctaaatccagctccggctgtg
tatgaacttactccagaattaatggctgtcactgatattgtgctgcccaatgaaacagaa
gcgcaattactgacgggcatcaatgttattaatgacgagggtgttttaaaccgagttagc
gatgccctacaagcgaagggagtccaacggagtattatcacattaggagaagcgggatca
tttatcgctgatggtcaaaaaagatggtgggtacaacctgaaaaggtagacgcacaagat
actaccgcggcaggtgacacttttattggtacattagccagcgtcatagcacctgatttt
agtaatttagatgatgctgtgcagcgggccaacattgctagtgcaatcgctgtaacacgt
ccaggtgctattccttcaattcctacagataaagaggttgataactattga

DBGET integrated database retrieval system