KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_0718Help
Entry
LMES_0718         CDS       T02997                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lmk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMES_0718
Enzymes [BR:lmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LMES_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(765894..766835)
Genome map
AA seq 313 aa AA seqDB search
MKNKVVVLGSLNIDTIQMIDRLPNQGETITVNNQASTFGGKGANQAVAAARQGADVTMIG
AVGDDDRGRAFKQLLSDEGISTDYIFTKSQFTGSATIMLEPDGHNTIMVYGGANMNLTSA
DVEKARNIIANADVIVAQLEVPTEAIVAGFNIAKKNGVLTILNPAPITSHLDSNIISSTD
LIIPNETEAAALAHTEPTTKQSSLTALTSKLNKVGFSNVVVTLGSDGVYYHVNGSADILP
VFKVNAVDTTAAGDTFIGTFSANIDDNLSNLPSVIRRSCFASSIAVSRSGAIASIPNKKD
VDAGLLANAAMAE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaggttgttgttctcggtagtctcaatattgatactattcaaatgattgat
agattacctaaccaaggagaaaccatcaccgttaacaatcaagcaagtacatttggtggt
aaaggtgccaatcaggcagttgcagctgctcgtcaaggagctgatgtaacaatgatcggt
gctgtaggtgatgatgaccgtggacgtgccttcaaacaattattaagtgatgaaggaata
tcaacggattatatttttacaaagagccagtttactggttccgccactataatgttggag
ccagatggacataacacgattatggtatatggtggtgcaaatatgaatttaaccagcgcc
gatgtggaaaaagcgcgcaatataattgctaatgctgatgtaatcgttgcacagcttgaa
gtacctactgaagccattgttgctgggtttaatatcgccaagaaaaatggcgtactaact
atattaaatccggcacctattacgtcacatcttgattcaaatattatttcatctactgat
ttaatcataccaaacgaaactgaagccgcggcactagctcacactgagccaaccacaaaa
caatcatcgttaacggcactcacttccaaattaaataaagtaggtttttccaacgtagtg
gttacacttggcagtgatggtgtttactatcatgtcaatgggtcggcagatattttacct
gttttcaaggtaaatgccgttgataccactgctgctggcgacacattcattggtactttt
tcagctaatattgacgacaacttgtcgaatctaccaagtgtcattcgacgtagttgcttt
gctagttcaatagccgtcagccgatctggtgcaatagcctcgattccaaataaaaaagac
gttgacgctggtttgcttgctaatgctgctatggcggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system