KEGG   Leuconostoc mesenteroides KFRI-MG: LMES_1465Help
Entry
LMES_1465         CDS       T02997                                 

Definition
Phosphoenolpyruvate carboxylase (archaeal type)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lmk  Leuconostoc mesenteroides KFRI-MG
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMES_1465
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMES_1465
  Energy metabolism
   00680 Methane metabolism
    LMES_1465
Enzymes [BR:lmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LMES_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1522871..1524385
Genome map
AA seq 504 aa AA seqDB search
MTSRKIPSIMGTQHPDNANAPFWESSQQPFISAYRETGEAFENFNELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKDHQIGRDKFLTFRFPNIWEEKGYNLMQAMTAFLSSEDFAHDL
GFSRPLFEAILPMAQRADQILKMQVLFEKLANFKSAEFTRSDKNTPYIEMIPLFEDFETQ
LHAPEILKEYLNLHEEHFGFRPKYMRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAEE
ENIEIFPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATVQSAFRYDFPIEEVQKGIAEL
KEKLPVAEPLKISLDDQKILTEIAEESAKFYSNTLDNLVPSMQAIFKAFPKRRDRRQHVG
VLGYSRSVDGIELPRAINFTGSFYSVGVPPEFIGFGRALKHLDADHLSVFVRSYPSMSKD
FNELARFVNMDALQILKTQNAAWAEVEEDILIMQRIFKFEIGPQTREEQQHAEIALQVVQ
FKDGAPVAITALINRMAQLRHFLG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgtaaaatcccttcaatcatgggaacgcaacatccagataatgctaatgcg
ccattctgggaaagttctcagcaaccatttatcagtgcctatcgagaaaccggtgaagca
tttgaaaactttaatgaattaaatgtcgatgagtatatgtgggattgggaaggtaaacat
gctgatgcagctgtcattgatcgcttgtttagcacagagtatgattatttcaaagatcat
caaatcggtcgtgacaagtttttaactttccgtttccctaatatttgggaagaaaaaggc
tacaacttaatgcaagcgatgaccgccttcttaagttctgaagacttcgcccatgatctt
ggattctctcgaccattatttgaagctattctgccaatggcacagcgtgcagaccaaatt
ttgaaaatgcaagttttgtttgaaaaattagcaaatttcaaatcagcagaatttactcgc
tctgataaaaacacaccctatattgaaatgatccctctttttgaggattttgaaacgcaa
ttacatgcacctgaaattttaaaggagtatttaaacctccacgaagaacattttggcttc
cgaccaaaatatatgcgtgtattcttagccggatcggattctgctttaacagctggattt
atgagttcaattaccggtaacaaactagcaattgcgcgacttcatgagtttgctgaagaa
gaaaacattgaaattttcccaatttcaggaaccggatcagcaattttccgtggtggttta
tctccacaccgcatcgatcgctacgtaacagaatttccaggggtacgcacagcaactgtt
caatcagcattccgttacgactttcctattgaagaagtgcaaaaaggcatcgctgaatta
aaagaaaaattgccggttgcagaaccattaaaaatttctcttgatgatcaaaagatttta
actgagatagctgaagagtccgctaagttttattctaatacgctagacaatttggttcct
agcatgcaagcgattttcaaggcgttcccaaagcgtcgtgatcgccgtcaacacgttggt
gttcttggatattcacgttcagttgatggcatcgaattaccaagggccattaacttcact
ggctcattctactcagtcggtgtcccaccagaatttattggttttgggcgcgcattgaag
catttagatgctgatcatttgagcgtatttgttcgctcatatcctagcatgagcaaagac
tttaatgaattagcacgcttcgttaatatggatgctttgcaaattctaaaaactcaaaat
gctgcttgggccgaagttgaagaagatattctcatcatgcaacgtattttcaagtttgaa
attggtcctcaaacgcgcgaagaacaacaacatgctgaaatagcacttcaagtagtgcaa
tttaaagatggtgctccagttgccattacagcccttattaaccgcatggcacaattacga
cacttcctcggataa

DBGET integrated database retrieval system