KEGG   Listeria monocytogenes L99: lmo4a_0017Help
Entry
lmo4a_0017        CDS       T01989                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lml  Listeria monocytogenes L99
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo4a_0017
Enzymes [BR:lml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lmo4a_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20426..21859
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKGFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPSKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEANPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVAEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaaggcttcttatggggcggagcagttgctgccaaccaa
tgtgagggagcttatcttgaagacggtaaaggactttcacttgttgacatccttccaaca
gtagaggatggacgttgggaagctttattcaatccatcgaaagcgcttgctacagattat
ggtttttatccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggcagaaatgggattcaagtgtttccgtatgtccatcagctggccacgtattttc
ccgaatggtgacgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcataaatatggcatcgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggcggttggaaaaatcgtaaatgtatcgacttttactta
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaatcaacatgattcttcatctgccatacattggtggaggtttagacgttactaaa
gaagctaatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatctgct
ttagcgacaaaacttggtcatgaaatcaaccctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacgtatccaatgacttgtaatccaaaagatgtctggaaatctatcgaggca
gaccgtgaaggctacttcttcattgacgttcaagcgcgcggatactacccaagctacact
aaacgtttcttcaaagaacacaacatcaacattaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattacgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggttggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttaccaaaaacctcttttcatcgttgaaaatggcttaggtgca
gtggatactgtggcagaagacggctcaatcactgacgattacagaatcgactacatgcgt
gaacacgttcgcgaaatgggcgaagcaatcgaggacggcgtggaacttcttggttataca
ccatggggctgcatcgaccttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctacgttgaccgcgacaacaaaggcaacggaaccctaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactag

DBGET integrated database retrieval system