KEGG   Listeria monocytogenes L99: lmo4a_0286Help
Entry
lmo4a_0286        CDS       T01989                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lml  Listeria monocytogenes L99
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lml01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lml00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310520..311659
Genome map
AA seq 379 aa AA seqDB search
MERERKIQILKDIVNIDSTNGHEEQVANYLQKLFAEYGIESEKVQYDVDRASLVSEIGSN
DGKVLAFSGHMDVVDAGDVSKWKFPPFEAAEHEGKIYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKALLQGNIRSISEMDNETVKQVLVKIINKLNKQENVNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaggaacaggttgcgaactacttacagaagttgtttgctgagtatggtattgag
tctgaaaaggtgcaatatgatgtagaccgagctagtcttgttagtgaaattggttctaat
gatggcaaagttttggcgttttcagggcatatggatgtagttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcagcagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaaatcaggtctagcggcgatggttattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagcggacaccggattgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccggaatttggtgtgaatgcgatt
gataacttgctgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcactgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgctactgcaagggaatattcgctcgatttcagaaatggat
aatgaaacagtgaaacaagtgctagtgaagatcatcaataagttaaacaaacaggaaaat
gtgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccgtta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system