KEGG   Listeria monocytogenes L99: lmo4a_0363Help
Entry
lmo4a_0363        CDS       T01989                                 

Gene name
tpiA-1
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lml  Listeria monocytogenes L99
Pathway
lml00010  Glycolysis / Gluconeogenesis
lml00051  Fructose and mannose metabolism
lml00562  Inositol phosphate metabolism
lml01100  Metabolic pathways
lml01110  Biosynthesis of secondary metabolites
lml01120  Microbial metabolism in diverse environments
lml01130  Biosynthesis of antibiotics
lml01200  Carbon metabolism
lml01230  Biosynthesis of amino acids
Module
lml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lml_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo4a_0363 (tpiA-1)
   00051 Fructose and mannose metabolism
    lmo4a_0363 (tpiA-1)
   00562 Inositol phosphate metabolism
    lmo4a_0363 (tpiA-1)
Enzymes [BR:lml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lmo4a_0363 (tpiA-1)
Exosome [BR:lml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lmo4a_0363 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   lmo4a_0363 (tpiA-1)
  Exosomal proteins of melanoma cells
   lmo4a_0363 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAR83065
Position
complement(393946..394710)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLENFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
EITPVVCVGESLRANDTNELKSALHKQIEALFNTIQVAQFKNVVLAYEPEWAIGKANSAD
TSYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttgaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgacttaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcacgagaaaactagcgagatagcgaaaaaaattaaactagcgctggacgaa
gaaatcactcctgtcgtatgcgttggggaaagccttcgcgcgaatgatacaaacgagttg
aaaagcgcccttcacaaacaaatcgaagcgctgtttaacaccattcaagtagcacaattt
aaaaatgttgttctggcttatgaaccagaatgggcaattggtaaggcaaattccgctgac
accagttacatcgaaagcgctcatcaagctttgcgagaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaggaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system