KEGG   Listeria monocytogenes L99: lmo4a_0363Help
Entry
lmo4a_0363        CDS       T01989                                 

Gene name
tpiA-1
Definition
tpiA-1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lml  Listeria monocytogenes L99
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lmo4a_0363 (tpiA-1)
   01230 Biosynthesis of amino acids
    lmo4a_0363 (tpiA-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lmo4a_0363 (tpiA-1)
   00051 Fructose and mannose metabolism
    lmo4a_0363 (tpiA-1)
   00562 Inositol phosphate metabolism
    lmo4a_0363 (tpiA-1)
Enzymes [BR:lml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lmo4a_0363 (tpiA-1)
Exosome [BR:lml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lmo4a_0363 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   lmo4a_0363 (tpiA-1)
  Exosomal proteins of melanoma cells
   lmo4a_0363 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(393946..394710)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLENFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
EITPVVCVGESLRANDTNELKSALHKQIEALFNTIQVAQFKNVVLAYEPEWAIGKANSAD
TSYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttgaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgacttaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcacgagaaaactagcgagatagcgaaaaaaattaaactagcgctggacgaa
gaaatcactcctgtcgtatgcgttggggaaagccttcgcgcgaatgatacaaacgagttg
aaaagcgcccttcacaaacaaatcgaagcgctgtttaacaccattcaagtagcacaattt
aaaaatgttgttctggcttatgaaccagaatgggcaattggtaaggcaaattccgctgac
accagttacatcgaaagcgctcatcaagctttgcgagaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaggaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system