KEGG   Listeria monocytogenes L99: lmo4a_0589Help
Entry
lmo4a_0589        CDS       T01989                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lml  Listeria monocytogenes L99
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lml00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619221..620615
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRFFNDVGPTNTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
YPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIILNLTPSYPRSQNPADLKAA
HIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWLHKAIEEGANCHGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNDFKRTVKASGHWYKELSENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagaaaatttttggtggggaagtgcagcatccggcccacaaaca
gaaggcgcagcaaatgtagatggcagaaaaccaagtatttgggatcactggtacaaaatc
gaaccaggtcgtttctttaacgatgtaggacctacgaatacatctaatttttactatcaa
tataaagaagatattgctttaatgaaacaaactgggcataattctttccgtacttcgatt
cagtggtcacgtcttattccagatggtattggcgaagtgaatccgaaagcggttgatttt
tacaatcgcgttattgatgaaatgcttgcaaatgacgtggaaccatttatgaatttatat
cattttgatatgccaatgtcgatgcaagaaaaaggcggttttgaaagccgtgaagtagtt
gacgcgtatgcaacttttgcaaaaacttgttttgaattattcggagatcgcgtgaaacat
tggtttacttttaatgaaccaattgttcctgttgaagcgggctatttatacgatatgcac
tatccaaatgtggttgattttaaacgtgcgactcaggttgcttaccatactactttggca
catgcgcttgctgttaaagaattccacgcacttgaaattccagaaggccaaatcggaatc
attttaaacttaacaccgtcgtatccaagaagccaaaatccggcagatttaaaagcagct
catattgcggatttaattttcaaccgtagtttccttgatccggttacaaaaggggaattc
ccagctgaccttgtagaaattattcgcgaacatgacgcgcttccagaatataccgaagaa
gatttggcgataattaaaaacaacattattgatattttgggtgtaaattactaccaaccg
cgtcgtgtgaaagcgaaagaatacgcagctcaccctgatgcaccatttatgccagaacat
ctttttgataactatgaaatgccttaccgtaaaatgaatccgtatcgtggctgggaaatt
tttgaaagagcgatttatgatattgcgattaatctgcgcgacaactacgataatatcccg
ttctttatttctgaaaatggtatgggtgtagaaggcgaaagtcgctaccgtaatgcagat
ggaatgattgaagatacgtaccgaatcgatttcattaagagtcacttgaaatggcttcat
aaagcaattgaagaaggcgctaattgtcacggttaccacctttggacgttcatggattgc
tggagctgggcgaatgcttacaaaaaccgttacggcctagtagaagtagatttggacaat
gatttcaaacgtactgtaaaagcttctggtcattggtacaaagaactttcagaaaacaat
ggttttgaagactaa

DBGET integrated database retrieval system