KEGG   Listeria monocytogenes L99: lmo4a_0999Help
Entry
lmo4a_0999        CDS       T01989                                 

Gene name
bsaA
Definition
bsaA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lml  Listeria monocytogenes L99
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    lmo4a_0999 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    lmo4a_0999 (bsaA)
Enzymes [BR:lml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     lmo4a_0999 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013716..1014195
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVELFPSKMKPADFEDKVEALVAKVSK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggcaaagaaatagctttaagtgat
tataaaggcaaggtattacttatcgtgaatacagcgagcaaatgtggcttaacacctcag
cttgaaggcctagaagccatgtataaaaaattgggtggcgctaattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagatcctgggagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgacgttccaaatgttctctaaaattaaagtgaaaggcaaa
gacgccagcccgctttataaatatttaaccgaacaaactggtggtaaaaaagtagaatgg
aattttgcgaaattcttaattgatgaaaatggcgaagtggttgaacttttcccatcaaaa
atgaaaccagcagattttgaggataaagtggaagcacttgttgcgaaagtaagtaaataa

DBGET integrated database retrieval system