KEGG   Listeria monocytogenes L99: lmo4a_1183Help
Entry
lmo4a_1183        CDS       T01989                                 

Gene name
cobA
Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lml  Listeria monocytogenes L99
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lml00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1184226..1185707
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALRKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQEEIEQILVREAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLENGRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVVDVAPTKTREALIEIN
ELLFTSKEAVERFFDYLTKLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNASNLIIGSIVDTSEVNAILAEVEAMEMMPLYDMRPVTERPFDLASFEQ
VCFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtcatgttaattggtgcaggtcctggagatgcacagttgctaaccgtgaaa
ggcttagctgcactgcgaaaggcagatgttattgtatacgatcgcctcgttgaaccagcg
atgctccaagaacgaaaagctagttgtaaactcatttatgtcggaaaagaaccacttcat
catccaattccccaagaggaaatcgaacaaattcttgttagagaggctgcgacaaatgag
ctggttgttcgtctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaagga
gagacactctataaagcgggaattccatttgaagttattcctggaatcacatccgcgatt
ggtgggcttgcctacgctggaattccagtaacccatcgtgattttgcttcgagttttcac
gtgattactggacatttgaaaaaaggacgtgatccactagattgggaagcccttgctaga
ctggaaggtacgctcgttttcctaatgggaatgactaatttacctaatatttgtgcgaac
ctactagaaaatggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgc
ggcaaacaattaacggttaccgggaacttacaaaacatcgaacaaaaagtagcggagtct
ggtatttcttcgccggcacttattgtcgttggtgatgtggtgagcttacgaccacagctt
aacttctttgaggaaatgcctcttttccatacaaaagtattacttccaagagcacgagct
ggaaaaagtatgctcgcggaacaaattcgcgatttgggcggagaagtaactatgtatcca
aatattcaagtagtcgatgttgcgccaacgaaaacaagggaagcgctaatcgaaataaac
gaacttcttttcacatctaaagaagcggtagaacgatttttcgactatttaaccaagctt
gatttagatattcgttctctaaaaaatacccatcttactgctattggcaaacaaacaaaa
gaagcttttagtgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttaattttggagcatttaccacggttacagaaaaatgcgagcaacttaattatcggaagc
atagttgatacgtcggaagttaacgcaattttagcagaagtggaagcgatggaaatgatg
ccgttatatgatatgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaa
gtttgtttctcaagttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaa
aaagccattttacaaacgaaaacaattctttccattggaaggttcacgagcgcaacgtta
gcatcattcggtatcaacaactttatcgaagccgaaagcgccacaccagagagcttaatt
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system