KEGG   Listeria monocytogenes L99: lmo4a_1594Help
Entry
lmo4a_1594        CDS       T01989                                 

Gene name
glpK
Definition
(GenBank) Glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
lml  Listeria monocytogenes L99
Pathway
lml00561  Glycerolipid metabolism
lml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    lmo4a_1594 (glpK)
Enzymes [BR:lml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     lmo4a_1594 (glpK)
Exosome [BR:lml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lmo4a_1594 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CAR84298
Position
complement(1588672..1590165)
Genome map
AA seq 497 aa AA seqDB search
MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHNANEIWASILAVI
AGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTEDICKQLRKDGY
EDTIRSKTGLLIDPYFAGTKARWILDHVDGAQERAEKGELLFGTIDTWLVWKLTGGRAHI
TDYSNASRTLLYNIYDLEWDDELLKMLNIPRAMLPEVRPSSEVYADTVPYHFFGEEVPVA
GIAGDQQAALFGQGCFEKGMAKNTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGKVEY
ALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSDV
RGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLKTLRVDGGASANNFLMQ
FQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDKRFEVEMKDEQRE
DLYEGWHKAVKAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatatattttagcactggatcaaggaacaacgagttcaagagcgatgatt
attgatgaagaaggagaagttattggcgttgcacaagaagaatttgatcaaatttttcct
aagccaggctgggtagaacataatgccaatgaaatctgggcatcgattttagctgtaatt
gcaggcgtattactcaaaacaaatatttcttctaaagaaattgcggggattggtattaca
aaccaacgtgaaactactgttatttgggataaagaaagcggaaatccaatctataatgcg
attgtttggcaatctcgtcaaactgaagatatttgtaaacaattacgtaaagatggctat
gaagatactattcgttctaaaactggtcttttaatcgatccatactttgcgggtacaaaa
gctcgctggattttggatcatgtggatggcgcacaagaacgtgctgaaaaaggagaactt
ctttttggaacgattgatacgtggctagtctggaaattaactggtggtcgtgctcatatt
accgactattccaatgcttctcggacacttctttataatatttatgatttagaatgggat
gatgagcttctaaaaatgcttaatatcccaagagcaatgttacctgaagttcgtccttcc
tctgaagtgtatgcagatacagtgccttatcacttctttggcgaagaagttccggttgca
ggtattgctggtgaccaacaagccgctttattcggacaaggttgttttgaaaaagggatg
gcgaaaaatacttacggaactggttgtttcttactcatgaacacgggagaaaaagctgta
cgttctgaaaatggtctattaacgacacttgcttggggtattgatggcaaagtagaatat
gcacttgaaggtagtattttcgttgctggttctgctattcagtggttacgtgatggcttg
cgtatggttcgtcaatcaagtgattctgaaaactatgcaagtcgaattgaatcaagtgac
ggtgtgtacgtagtgccggcgttcgttggtttaggtgcgccttactgggattcagatgtt
cgtggagctgtatttggattaactcgtggtacagaaaaagaacaatttatccgtgcaaca
ttggaatctcttgcctatcaaacaagagacgtactttatgcaatggaacaagattctggt
attagcttaaaaacattacgcgtggatggcggggcttctgctaataatttcttaatgcaa
ttccaatccgatattctaggtgttccagtagagcgcccagaaaacaaagaaacaactgta
ctaggagcagctttcttagcaggtctggcagttggtgtttggaaagacaagaacgaaatt
aaaaaacattggaaactagataaacgttttgaagtagaaatgaaagatgaacaaagagaa
gatttatatgaaggttggcataaagctgtcaaagctgcacaagcctttaaataa

DBGET integrated database retrieval system