KEGG   Listeria monocytogenes L99: lmo4a_1594Help
Entry
lmo4a_1594        CDS       T01989                                 

Gene name
glpK
Definition
glpK (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lml  Listeria monocytogenes L99
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lml00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1588672..1590165)
Genome map
AA seq 497 aa AA seqDB search
MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHNANEIWASILAVI
AGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTEDICKQLRKDGY
EDTIRSKTGLLIDPYFAGTKARWILDHVDGAQERAEKGELLFGTIDTWLVWKLTGGRAHI
TDYSNASRTLLYNIYDLEWDDELLKMLNIPRAMLPEVRPSSEVYADTVPYHFFGEEVPVA
GIAGDQQAALFGQGCFEKGMAKNTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGKVEY
ALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSDV
RGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLKTLRVDGGASANNFLMQ
FQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDKRFEVEMKDEQRE
DLYEGWHKAVKAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatatattttagcactggatcaaggaacaacgagttcaagagcgatgatt
attgatgaagaaggagaagttattggcgttgcacaagaagaatttgatcaaatttttcct
aagccaggctgggtagaacataatgccaatgaaatctgggcatcgattttagctgtaatt
gcaggcgtattactcaaaacaaatatttcttctaaagaaattgcggggattggtattaca
aaccaacgtgaaactactgttatttgggataaagaaagcggaaatccaatctataatgcg
attgtttggcaatctcgtcaaactgaagatatttgtaaacaattacgtaaagatggctat
gaagatactattcgttctaaaactggtcttttaatcgatccatactttgcgggtacaaaa
gctcgctggattttggatcatgtggatggcgcacaagaacgtgctgaaaaaggagaactt
ctttttggaacgattgatacgtggctagtctggaaattaactggtggtcgtgctcatatt
accgactattccaatgcttctcggacacttctttataatatttatgatttagaatgggat
gatgagcttctaaaaatgcttaatatcccaagagcaatgttacctgaagttcgtccttcc
tctgaagtgtatgcagatacagtgccttatcacttctttggcgaagaagttccggttgca
ggtattgctggtgaccaacaagccgctttattcggacaaggttgttttgaaaaagggatg
gcgaaaaatacttacggaactggttgtttcttactcatgaacacgggagaaaaagctgta
cgttctgaaaatggtctattaacgacacttgcttggggtattgatggcaaagtagaatat
gcacttgaaggtagtattttcgttgctggttctgctattcagtggttacgtgatggcttg
cgtatggttcgtcaatcaagtgattctgaaaactatgcaagtcgaattgaatcaagtgac
ggtgtgtacgtagtgccggcgttcgttggtttaggtgcgccttactgggattcagatgtt
cgtggagctgtatttggattaactcgtggtacagaaaaagaacaatttatccgtgcaaca
ttggaatctcttgcctatcaaacaagagacgtactttatgcaatggaacaagattctggt
attagcttaaaaacattacgcgtggatggcggggcttctgctaataatttcttaatgcaa
ttccaatccgatattctaggtgttccagtagagcgcccagaaaacaaagaaacaactgta
ctaggagcagctttcttagcaggtctggcagttggtgtttggaaagacaagaacgaaatt
aaaaaacattggaaactagataaacgttttgaagtagaaatgaaagatgaacaaagagaa
gatttatatgaaggttggcataaagctgtcaaagctgcacaagcctttaaataa

DBGET integrated database retrieval system