KEGG   Listeria monocytogenes L99: lmo4a_2152Help
Entry
lmo4a_2152        CDS       T01989                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lml  Listeria monocytogenes L99
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lml00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2190091..2190741)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKVVKTMFDRFETNAAGGNVSVRMNNEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLEFAPATSPELAEIVRKHVIELGEKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcaaaagtagtgaagacgatgtttgaccgc
tttgaaacgaatgcggctggaggaaatgttagtgtgcgcatgaataatgagcatattatt
atgacgccaacgctgatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtcgtagaaggagacggaagagttactagagaaattaac
ttacaccgcgcttgttacgtagaaaatccaaaaatcggctgtgtactccatgctcatcca
aaagaatccatgctatttgccacacttgggatggaattaccgaatttaacagaagcaacg
caaaaaattggacaaattccaacacttgaatttgcgccagcgactagtccagaacttgcg
gaaatcgttcgtaaacacgttatcgaactaggggaaaaagctgttcctagtgcaagttta
ttaaataaacacggtattgtcgtattagatacatcgcttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctatattgcagaaaaagcgttagtatttgatgctttaggt
attaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

DBGET integrated database retrieval system