KEGG   Listeria monocytogenes L99: lmo4a_2453Help
Entry
lmo4a_2453        CDS       T01989                                 

Gene name
est-1
Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
lml  Listeria monocytogenes L99
Brite
Enzymes [BR:lml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     lmo4a_2453 (est-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH BAAT_C DUF2048 FSH1 Abhydrolase_4 UPF0227
Motif
Other DBs
NCBI-ProteinID: CAR85157
Position
complement(2508678..2509424)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENDYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTPEQIDAEMVAYKDAPMNTIAKLKDEINGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELRWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacgattatacttgctatgcgcctcaatacagaggccacggtgtatctcctgacctactg
ttaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggttacacggaaatcgctgtagcgggactttcgctaggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagttcatcaccaataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacacctgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aacaccatcgctaaactaaaggacgagataaatggcgtcgtggctgaaatagatatgatt
tatgcgccaataatggtcgtccaaggtgaaaaagacgatatggttgatgtgagcggagcg
cagctaatttatgatacagtagagtcaacgaagaaagaattacgctggtttaaagaatct
ggtcatgtcatcactttagacaaagaacgaaaagaagtaaatcaagccattttaacattt
ttagatagtttagattggcaagaatag

DBGET integrated database retrieval system