KEGG   Listeria monocytogenes L99: lmo4a_2548Help
Entry
lmo4a_2548        CDS       T01989                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lml  Listeria monocytogenes L99
Pathway
lml00260  Glycine, serine and threonine metabolism
lml00750  Vitamin B6 metabolism
lml01100  Metabolic pathways
lml01110  Biosynthesis of secondary metabolites
lml01120  Microbial metabolism in diverse environments
lml01230  Biosynthesis of amino acids
Module
lml_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lmo4a_2548 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lmo4a_2548 (thrC)
Enzymes [BR:lml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lmo4a_2548 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: CAR85252
Position
complement(2607079..2608134)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatttcacttgcggaaggaaatacaccacttatcccattaccgaatttgtccaaagaa
cttggtgttactttatacggaaaatatgaaggcttaaatccaaccggttcttttaaagac
cgtggaatggttatggctgtcgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggtaaagttgccttaggaaaattagcgcaagcagttatg
tacggagcagatattatctcgattcaaggtaattttgacgaagcattaaaatcggttcgt
gaattggctgaaacagaagcagtaacgcttgtaaactcggtaaatccttatcgtttagaa
ggtcaaaaaacagctgcattcgaaatttgtgagcaattaggttctgctccagatgtcctt
gctattccagtcggtaatgccggaaatatttctgcatactggaaaggatttaaagagtgg
aatgaggctaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggct
gcgattgttcaaggtaaaccgattgataatccggaaacaattgcaacagcgattcgtatc
ggaaatccagctagttgggggcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgttaatgcctataaaaaaattgcagcgcaagatggt
gtcttcatcgagccaggttcagctgcttcattagctggtgtaatccaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagttgtttgtgtctttactggaaatgggttaaaagat
ccggatactgcgatgagtgtgcatgaaattccaatttctcatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system